Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W2SBS0

Protein Details
Accession W2SBS0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
98-125LSPKDASRVTQKQKKRTTHFPVRKYAVKHydrophilic
NLS Segment(s)
PositionSequence
89-113KQTRAIRRRLSPKDASRVTQKQKKR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSTARVKSSSLWGKSKDDLAKQLDELKTELGQLRVQKIAGGASSKLTRIHDLRKSIARVLTVINANQRHSLRQFYSKKKYLPLDLRAKQTRAIRRRLSPKDASRVTQKQKKRTTHFPVRKYAVKAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.5
3 0.54
4 0.5
5 0.45
6 0.46
7 0.44
8 0.42
9 0.39
10 0.44
11 0.37
12 0.33
13 0.3
14 0.25
15 0.21
16 0.2
17 0.21
18 0.16
19 0.17
20 0.19
21 0.2
22 0.2
23 0.19
24 0.18
25 0.16
26 0.15
27 0.13
28 0.12
29 0.1
30 0.11
31 0.12
32 0.13
33 0.14
34 0.15
35 0.18
36 0.19
37 0.26
38 0.29
39 0.31
40 0.34
41 0.37
42 0.37
43 0.36
44 0.34
45 0.27
46 0.23
47 0.2
48 0.19
49 0.15
50 0.14
51 0.17
52 0.17
53 0.17
54 0.21
55 0.2
56 0.2
57 0.2
58 0.24
59 0.21
60 0.3
61 0.37
62 0.42
63 0.51
64 0.54
65 0.54
66 0.57
67 0.58
68 0.57
69 0.56
70 0.56
71 0.58
72 0.57
73 0.63
74 0.61
75 0.59
76 0.55
77 0.55
78 0.56
79 0.53
80 0.58
81 0.55
82 0.6
83 0.69
84 0.72
85 0.72
86 0.72
87 0.72
88 0.73
89 0.7
90 0.65
91 0.64
92 0.66
93 0.69
94 0.68
95 0.69
96 0.69
97 0.75
98 0.82
99 0.8
100 0.81
101 0.81
102 0.84
103 0.86
104 0.83
105 0.84
106 0.8
107 0.8
108 0.74