Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W2RKE4

Protein Details
Accession W2RKE4   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
76-97TSSKVPGRGRGRPKKNAPLPADHydrophilic
NLS Segment(s)
PositionSequence
81-91PGRGRGRPKKN
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR045127  TAF11-like  
IPR006809  TAFII28_dom  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0046982  F:protein heterodimerization activity  
GO:0051123  P:RNA polymerase II preinitiation complex assembly  
Pfam View protein in Pfam  
PF04719  TAFII28  
Amino Acid Sequences MATSPPSPFPPTLPNPKKRPSMSSQTSTTSAAKRRQLHPLRQTSFPAAVAGAYDSAITPSARSETGSIANSTFSATSSKVPGRGRGRPKKNAPLPADKDDTARSTTTKGGAAKSVVSGKSGARSEAGGDEDEDDDDEEVEVEITADEKKREEEEDTRRADRERMLASAFNEEQRTRYTQYRSWKIEPKNVRRIINQVMSQSSVDRVVSTVSWTSKLFAGLLVEGARDVQKEWAEAYDKTREEEKKWRRAELERLLLKREEGGMGEQEKVLVQRDIERLKKESEEYIPNPHRGGLLPDHLREALRRYKADGEGFGAGMQGSSHSLLGVPGSVAYRAGDGTTGRRLFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.67
3 0.74
4 0.8
5 0.75
6 0.75
7 0.72
8 0.73
9 0.71
10 0.69
11 0.65
12 0.6
13 0.58
14 0.54
15 0.5
16 0.46
17 0.45
18 0.46
19 0.5
20 0.53
21 0.55
22 0.63
23 0.68
24 0.71
25 0.74
26 0.77
27 0.72
28 0.69
29 0.69
30 0.63
31 0.55
32 0.45
33 0.36
34 0.25
35 0.21
36 0.17
37 0.14
38 0.09
39 0.07
40 0.07
41 0.06
42 0.06
43 0.08
44 0.07
45 0.07
46 0.08
47 0.1
48 0.1
49 0.11
50 0.12
51 0.13
52 0.18
53 0.19
54 0.19
55 0.17
56 0.17
57 0.16
58 0.16
59 0.13
60 0.1
61 0.1
62 0.1
63 0.12
64 0.17
65 0.19
66 0.24
67 0.26
68 0.34
69 0.38
70 0.46
71 0.56
72 0.61
73 0.69
74 0.72
75 0.79
76 0.81
77 0.82
78 0.82
79 0.77
80 0.77
81 0.74
82 0.7
83 0.66
84 0.56
85 0.5
86 0.43
87 0.39
88 0.31
89 0.26
90 0.21
91 0.18
92 0.19
93 0.19
94 0.21
95 0.2
96 0.19
97 0.2
98 0.2
99 0.18
100 0.18
101 0.2
102 0.17
103 0.16
104 0.16
105 0.14
106 0.19
107 0.19
108 0.17
109 0.13
110 0.13
111 0.13
112 0.14
113 0.14
114 0.1
115 0.09
116 0.1
117 0.09
118 0.09
119 0.08
120 0.07
121 0.06
122 0.06
123 0.05
124 0.04
125 0.04
126 0.04
127 0.04
128 0.03
129 0.03
130 0.04
131 0.05
132 0.06
133 0.07
134 0.07
135 0.09
136 0.1
137 0.12
138 0.15
139 0.22
140 0.28
141 0.35
142 0.38
143 0.38
144 0.38
145 0.38
146 0.36
147 0.3
148 0.27
149 0.21
150 0.19
151 0.18
152 0.19
153 0.19
154 0.2
155 0.19
156 0.16
157 0.16
158 0.15
159 0.15
160 0.15
161 0.18
162 0.17
163 0.21
164 0.24
165 0.27
166 0.36
167 0.43
168 0.47
169 0.49
170 0.55
171 0.53
172 0.58
173 0.63
174 0.63
175 0.65
176 0.65
177 0.62
178 0.56
179 0.57
180 0.54
181 0.49
182 0.42
183 0.34
184 0.29
185 0.27
186 0.26
187 0.21
188 0.16
189 0.12
190 0.1
191 0.08
192 0.07
193 0.07
194 0.07
195 0.08
196 0.09
197 0.09
198 0.11
199 0.11
200 0.12
201 0.12
202 0.13
203 0.11
204 0.09
205 0.09
206 0.08
207 0.08
208 0.07
209 0.06
210 0.06
211 0.06
212 0.06
213 0.06
214 0.06
215 0.09
216 0.09
217 0.1
218 0.1
219 0.12
220 0.15
221 0.15
222 0.19
223 0.22
224 0.22
225 0.24
226 0.3
227 0.3
228 0.33
229 0.43
230 0.48
231 0.51
232 0.54
233 0.57
234 0.55
235 0.59
236 0.64
237 0.62
238 0.62
239 0.59
240 0.57
241 0.56
242 0.51
243 0.45
244 0.37
245 0.29
246 0.2
247 0.14
248 0.14
249 0.15
250 0.16
251 0.16
252 0.15
253 0.14
254 0.14
255 0.14
256 0.14
257 0.11
258 0.1
259 0.15
260 0.22
261 0.29
262 0.33
263 0.36
264 0.37
265 0.39
266 0.41
267 0.38
268 0.36
269 0.35
270 0.39
271 0.37
272 0.45
273 0.47
274 0.47
275 0.45
276 0.41
277 0.36
278 0.29
279 0.31
280 0.25
281 0.29
282 0.31
283 0.31
284 0.33
285 0.33
286 0.33
287 0.3
288 0.31
289 0.31
290 0.33
291 0.34
292 0.35
293 0.41
294 0.45
295 0.47
296 0.42
297 0.37
298 0.32
299 0.31
300 0.27
301 0.21
302 0.15
303 0.12
304 0.1
305 0.07
306 0.07
307 0.08
308 0.08
309 0.07
310 0.08
311 0.08
312 0.08
313 0.08
314 0.07
315 0.07
316 0.08
317 0.09
318 0.09
319 0.09
320 0.1
321 0.09
322 0.09
323 0.1
324 0.11
325 0.15
326 0.24