Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W2SEI3

Protein Details
Accession W2SEI3   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
100-125TMLVSIRERYRQKPKRKAVVDTIAKGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10cyto 10cyto_nucl 10
Family & Domain DBs
Amino Acid Sequences MQNCTKLVNDAIRLAHEMRLTTTTYSWGTFNAGATESQLFYSGELGKYKLVDAKTGQKLKRSSVKDLASDTVIGDKVCTIFPALERKGSNRGKLALVEETMLVSIRERYRQKPKRKAVVDTIAKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.22
4 0.2
5 0.18
6 0.19
7 0.19
8 0.18
9 0.17
10 0.17
11 0.17
12 0.17
13 0.16
14 0.14
15 0.15
16 0.14
17 0.14
18 0.12
19 0.12
20 0.11
21 0.12
22 0.12
23 0.1
24 0.09
25 0.1
26 0.09
27 0.08
28 0.11
29 0.11
30 0.11
31 0.11
32 0.12
33 0.12
34 0.12
35 0.12
36 0.13
37 0.12
38 0.13
39 0.14
40 0.22
41 0.29
42 0.36
43 0.37
44 0.39
45 0.41
46 0.43
47 0.49
48 0.44
49 0.42
50 0.43
51 0.44
52 0.39
53 0.39
54 0.36
55 0.28
56 0.24
57 0.19
58 0.13
59 0.11
60 0.09
61 0.07
62 0.06
63 0.07
64 0.07
65 0.07
66 0.06
67 0.06
68 0.09
69 0.16
70 0.17
71 0.21
72 0.22
73 0.25
74 0.34
75 0.37
76 0.39
77 0.35
78 0.36
79 0.33
80 0.34
81 0.34
82 0.27
83 0.23
84 0.19
85 0.16
86 0.14
87 0.12
88 0.11
89 0.08
90 0.07
91 0.12
92 0.14
93 0.22
94 0.27
95 0.35
96 0.46
97 0.56
98 0.66
99 0.72
100 0.8
101 0.83
102 0.85
103 0.84
104 0.83
105 0.83