Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W2RVS8

Protein Details
Accession W2RVS8    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPPKKDSSKGKSKGKNESDTNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR043323  PIN4  
IPR046357  PPIase_dom_sf  
IPR000297  PPIase_PpiC  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF13616  Rotamase_3  
PROSITE View protein in PROSITE  
PS50198  PPIC_PPIASE_2  
Amino Acid Sequences MPPKKDSSKGKSKGKNESDTNGSGSKLKAAQSINARHILCEKHSKKEEALAKLRDGVKFDEENYEVAREFSEDKARQGGALGWKTRGSLHGEFEKVAYELQPSTTNSPQWAEVKTSHGYQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.75
4 0.71
5 0.66
6 0.58
7 0.54
8 0.45
9 0.37
10 0.3
11 0.26
12 0.23
13 0.2
14 0.19
15 0.21
16 0.2
17 0.25
18 0.3
19 0.35
20 0.35
21 0.39
22 0.38
23 0.34
24 0.36
25 0.33
26 0.28
27 0.34
28 0.33
29 0.36
30 0.39
31 0.41
32 0.38
33 0.44
34 0.47
35 0.43
36 0.47
37 0.4
38 0.37
39 0.4
40 0.41
41 0.35
42 0.3
43 0.24
44 0.21
45 0.19
46 0.19
47 0.17
48 0.16
49 0.16
50 0.14
51 0.14
52 0.1
53 0.1
54 0.09
55 0.07
56 0.08
57 0.09
58 0.17
59 0.17
60 0.18
61 0.2
62 0.2
63 0.19
64 0.18
65 0.19
66 0.18
67 0.22
68 0.22
69 0.22
70 0.22
71 0.23
72 0.23
73 0.23
74 0.22
75 0.2
76 0.23
77 0.27
78 0.27
79 0.27
80 0.27
81 0.25
82 0.19
83 0.18
84 0.13
85 0.1
86 0.1
87 0.12
88 0.15
89 0.17
90 0.22
91 0.25
92 0.26
93 0.26
94 0.28
95 0.3
96 0.29
97 0.29
98 0.27
99 0.26
100 0.29