Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074XVF8

Protein Details
Accession A0A074XVF8   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-89APAAAPTPRKRKPKLKAKKAASADDHydrophilic
95-114EGTPITKRPKVKREAQDDEEAcidic
NLS Segment(s)
PositionSequence
68-84AAPTPRKRKPKLKAKKA
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
Amino Acid Sequences MAPWNDSEDRQLLLSVITLAQVNPNWDDVATQMGKTKEAVRQRFAKLKKEAGDPPAAAASASTAAPAAAPTPRKRKPKLKAKKAASADDDEDEDEGTPITKRPKVKREAQDDEEEET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.08
4 0.07
5 0.07
6 0.07
7 0.09
8 0.1
9 0.12
10 0.12
11 0.13
12 0.12
13 0.12
14 0.12
15 0.1
16 0.14
17 0.13
18 0.12
19 0.15
20 0.15
21 0.16
22 0.17
23 0.2
24 0.2
25 0.28
26 0.32
27 0.33
28 0.39
29 0.43
30 0.5
31 0.51
32 0.54
33 0.5
34 0.51
35 0.5
36 0.49
37 0.47
38 0.42
39 0.41
40 0.33
41 0.28
42 0.23
43 0.19
44 0.14
45 0.1
46 0.08
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.06
56 0.11
57 0.16
58 0.25
59 0.33
60 0.42
61 0.5
62 0.59
63 0.67
64 0.74
65 0.81
66 0.83
67 0.86
68 0.84
69 0.85
70 0.8
71 0.76
72 0.69
73 0.62
74 0.53
75 0.43
76 0.38
77 0.29
78 0.24
79 0.18
80 0.14
81 0.1
82 0.08
83 0.07
84 0.07
85 0.1
86 0.16
87 0.2
88 0.29
89 0.38
90 0.48
91 0.55
92 0.65
93 0.71
94 0.76
95 0.8
96 0.77
97 0.77