Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EXR7

Protein Details
Accession A7EXR7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTRPSSPEKKRYQCFVHKQCIPHydrophilic
100-124KNVKDIPDPRKKNQKHDKDGGCGCSBasic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito_nucl 13.666, mito 11.5, cyto_nucl 8.833
Family & Domain DBs
KEGG ssl:SS1G_10132  -  
Amino Acid Sequences MTRPSSPEKKRYQCFVHKQCIPQLQGVNSTNSLWKPKSLRIQKSVPISIIPTDGRKPMHEAPNHANDTYHTKFQPVSRKPSGLGWSVYQEDVPSYNTPIKNVKDIPDPRKKNQKHDKDGGCGCSIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.81
4 0.77
5 0.74
6 0.73
7 0.71
8 0.63
9 0.57
10 0.52
11 0.44
12 0.45
13 0.42
14 0.37
15 0.31
16 0.29
17 0.27
18 0.24
19 0.27
20 0.21
21 0.24
22 0.25
23 0.31
24 0.4
25 0.47
26 0.52
27 0.53
28 0.58
29 0.58
30 0.61
31 0.56
32 0.47
33 0.38
34 0.32
35 0.26
36 0.23
37 0.19
38 0.14
39 0.14
40 0.16
41 0.16
42 0.16
43 0.21
44 0.24
45 0.3
46 0.3
47 0.33
48 0.34
49 0.41
50 0.42
51 0.36
52 0.3
53 0.24
54 0.31
55 0.28
56 0.27
57 0.19
58 0.19
59 0.21
60 0.26
61 0.35
62 0.32
63 0.38
64 0.39
65 0.4
66 0.4
67 0.43
68 0.42
69 0.34
70 0.31
71 0.24
72 0.24
73 0.24
74 0.23
75 0.18
76 0.15
77 0.12
78 0.12
79 0.13
80 0.11
81 0.13
82 0.19
83 0.2
84 0.22
85 0.28
86 0.29
87 0.33
88 0.35
89 0.35
90 0.39
91 0.47
92 0.54
93 0.58
94 0.63
95 0.65
96 0.74
97 0.76
98 0.77
99 0.8
100 0.82
101 0.81
102 0.84
103 0.82
104 0.8
105 0.8
106 0.73