Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7E5P9

Protein Details
Accession A7E5P9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
43-68VDNPLARDKSRRLRRRSKTVAATLDNHydrophilic
NLS Segment(s)
PositionSequence
51-58KSRRLRRR
Subcellular Location(s) extr 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR001461  Aspartic_peptidase_A1  
IPR001969  Aspartic_peptidase_AS  
IPR033121  PEPTIDASE_A1  
IPR021109  Peptidase_aspartic_dom_sf  
IPR033876  SAP-like  
Gene Ontology GO:0005576  C:extracellular region  
GO:0009277  C:fungal-type cell wall  
GO:0004190  F:aspartic-type endopeptidase activity  
GO:0031505  P:fungal-type cell wall organization  
GO:0006508  P:proteolysis  
KEGG ssl:SS1G_00624  -  
Pfam View protein in Pfam  
PF00026  Asp  
PROSITE View protein in PROSITE  
PS00141  ASP_PROTEASE  
PS51767  PEPTIDASE_A1  
PS51257  PROKAR_LIPOPROTEIN  
CDD cd05474  SAP_like  
Amino Acid Sequences MRTSTFIAAAVGLLSACTDAVQLQRRSDGSARVVALDMVRKQVDNPLARDKSRRLRRRSKTVAATLDNEETLYFVNGTLGTPAQSLRLHIDTGSSDLWVNTATSTLCSERRSPCQTAGTYSANSSSTYAYLASDFNISYVDGSGASGDYVTDTFTIGSTTLDKLQFGIGYTSSSPEGILGIGYEINEVQVGRARKSAYKNLPAQMVADGLINSNAFSLWLNDLDSSTGSVLFGGVDTARYHGQLETLPIQKESGYYAEFLITLTEVTLGNLVIAQDQSLAVLLDSGSSLTYLPDAMAEAIYEQVDAQYDYSEGAAYVPCSLASNSSALNFTFTSPTIQVTMDELVIPVTSSNGQQLRFTDGTAACLFGIAPAGESTAVLGDTFIRSAYVVYDLANNEISLAQTNFNATATNVVEITTGTSAVPNAALVSNAATASTDSSGAVISGSVTLNSGSKSKNAGAFQTPPPLAYGMAALGAGLFYAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.04
5 0.05
6 0.06
7 0.13
8 0.22
9 0.25
10 0.27
11 0.32
12 0.33
13 0.38
14 0.39
15 0.39
16 0.35
17 0.36
18 0.35
19 0.31
20 0.31
21 0.27
22 0.26
23 0.25
24 0.23
25 0.22
26 0.22
27 0.21
28 0.22
29 0.28
30 0.34
31 0.34
32 0.38
33 0.43
34 0.48
35 0.51
36 0.56
37 0.58
38 0.61
39 0.66
40 0.71
41 0.71
42 0.77
43 0.84
44 0.88
45 0.89
46 0.88
47 0.87
48 0.85
49 0.83
50 0.76
51 0.69
52 0.62
53 0.54
54 0.44
55 0.34
56 0.26
57 0.18
58 0.15
59 0.12
60 0.09
61 0.07
62 0.08
63 0.08
64 0.08
65 0.09
66 0.09
67 0.08
68 0.09
69 0.09
70 0.12
71 0.12
72 0.13
73 0.16
74 0.17
75 0.17
76 0.17
77 0.18
78 0.15
79 0.18
80 0.16
81 0.13
82 0.11
83 0.11
84 0.11
85 0.1
86 0.09
87 0.06
88 0.07
89 0.07
90 0.07
91 0.1
92 0.13
93 0.15
94 0.18
95 0.24
96 0.28
97 0.36
98 0.41
99 0.42
100 0.44
101 0.47
102 0.46
103 0.44
104 0.45
105 0.4
106 0.34
107 0.31
108 0.28
109 0.23
110 0.22
111 0.19
112 0.14
113 0.11
114 0.11
115 0.11
116 0.09
117 0.09
118 0.09
119 0.09
120 0.09
121 0.09
122 0.08
123 0.08
124 0.08
125 0.07
126 0.07
127 0.07
128 0.05
129 0.05
130 0.06
131 0.05
132 0.05
133 0.04
134 0.04
135 0.04
136 0.04
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.06
143 0.05
144 0.06
145 0.07
146 0.08
147 0.12
148 0.12
149 0.12
150 0.12
151 0.12
152 0.12
153 0.11
154 0.11
155 0.08
156 0.09
157 0.09
158 0.1
159 0.1
160 0.09
161 0.08
162 0.07
163 0.07
164 0.06
165 0.05
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.08
177 0.1
178 0.11
179 0.13
180 0.15
181 0.19
182 0.24
183 0.33
184 0.36
185 0.42
186 0.46
187 0.46
188 0.46
189 0.41
190 0.37
191 0.29
192 0.22
193 0.15
194 0.11
195 0.08
196 0.06
197 0.07
198 0.06
199 0.05
200 0.05
201 0.04
202 0.04
203 0.04
204 0.05
205 0.05
206 0.06
207 0.06
208 0.06
209 0.07
210 0.07
211 0.07
212 0.06
213 0.05
214 0.05
215 0.04
216 0.04
217 0.04
218 0.04
219 0.03
220 0.03
221 0.03
222 0.04
223 0.04
224 0.06
225 0.06
226 0.06
227 0.07
228 0.07
229 0.08
230 0.08
231 0.1
232 0.12
233 0.15
234 0.16
235 0.15
236 0.15
237 0.14
238 0.14
239 0.13
240 0.11
241 0.08
242 0.08
243 0.08
244 0.08
245 0.08
246 0.08
247 0.07
248 0.05
249 0.04
250 0.04
251 0.04
252 0.04
253 0.04
254 0.05
255 0.04
256 0.04
257 0.04
258 0.04
259 0.04
260 0.04
261 0.04
262 0.04
263 0.04
264 0.04
265 0.04
266 0.04
267 0.03
268 0.03
269 0.03
270 0.03
271 0.03
272 0.03
273 0.03
274 0.03
275 0.04
276 0.04
277 0.04
278 0.04
279 0.04
280 0.04
281 0.04
282 0.04
283 0.04
284 0.04
285 0.04
286 0.04
287 0.04
288 0.04
289 0.04
290 0.04
291 0.04
292 0.05
293 0.05
294 0.04
295 0.05
296 0.05
297 0.05
298 0.05
299 0.05
300 0.05
301 0.05
302 0.05
303 0.05
304 0.05
305 0.05
306 0.06
307 0.06
308 0.07
309 0.08
310 0.09
311 0.08
312 0.09
313 0.1
314 0.09
315 0.11
316 0.11
317 0.11
318 0.11
319 0.11
320 0.13
321 0.13
322 0.14
323 0.13
324 0.13
325 0.12
326 0.12
327 0.13
328 0.1
329 0.1
330 0.09
331 0.08
332 0.07
333 0.07
334 0.05
335 0.05
336 0.06
337 0.06
338 0.11
339 0.14
340 0.15
341 0.17
342 0.18
343 0.24
344 0.23
345 0.23
346 0.24
347 0.21
348 0.24
349 0.23
350 0.22
351 0.15
352 0.14
353 0.14
354 0.08
355 0.09
356 0.06
357 0.06
358 0.06
359 0.06
360 0.06
361 0.06
362 0.06
363 0.05
364 0.05
365 0.05
366 0.05
367 0.05
368 0.06
369 0.06
370 0.06
371 0.06
372 0.06
373 0.06
374 0.07
375 0.08
376 0.08
377 0.08
378 0.12
379 0.12
380 0.14
381 0.14
382 0.13
383 0.11
384 0.11
385 0.11
386 0.1
387 0.11
388 0.1
389 0.1
390 0.12
391 0.12
392 0.12
393 0.12
394 0.09
395 0.13
396 0.12
397 0.13
398 0.12
399 0.11
400 0.11
401 0.11
402 0.13
403 0.09
404 0.08
405 0.07
406 0.08
407 0.08
408 0.08
409 0.08
410 0.06
411 0.07
412 0.07
413 0.07
414 0.07
415 0.08
416 0.09
417 0.08
418 0.08
419 0.07
420 0.08
421 0.09
422 0.1
423 0.09
424 0.08
425 0.08
426 0.08
427 0.08
428 0.08
429 0.06
430 0.05
431 0.07
432 0.07
433 0.07
434 0.07
435 0.08
436 0.09
437 0.11
438 0.14
439 0.14
440 0.16
441 0.21
442 0.24
443 0.3
444 0.31
445 0.34
446 0.37
447 0.41
448 0.42
449 0.47
450 0.43
451 0.37
452 0.36
453 0.32
454 0.27
455 0.22
456 0.19
457 0.1
458 0.1
459 0.09
460 0.07
461 0.06
462 0.06