Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074X7P4

Protein Details
Accession A0A074X7P4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-79VLDQRSKCRKCRIKGQKLLSVSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MMSLSKRGRCFYQLLAPAPSVYGRDRWWWLRYWLALSVQRAARLAGSLTCPSQQTSTVLDQRSKCRKCRIKGQKLLSVSSGVKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.38
4 0.35
5 0.31
6 0.27
7 0.2
8 0.15
9 0.15
10 0.14
11 0.17
12 0.22
13 0.26
14 0.27
15 0.28
16 0.29
17 0.3
18 0.29
19 0.27
20 0.25
21 0.24
22 0.25
23 0.23
24 0.25
25 0.22
26 0.22
27 0.2
28 0.18
29 0.14
30 0.11
31 0.1
32 0.07
33 0.08
34 0.09
35 0.09
36 0.1
37 0.11
38 0.12
39 0.12
40 0.12
41 0.12
42 0.15
43 0.2
44 0.24
45 0.26
46 0.3
47 0.33
48 0.41
49 0.5
50 0.52
51 0.53
52 0.59
53 0.66
54 0.68
55 0.76
56 0.78
57 0.79
58 0.83
59 0.85
60 0.82
61 0.76
62 0.71
63 0.62
64 0.55