Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EZ52

Protein Details
Accession A7EZ52    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
23-45DDNTARKSKKSKTTKPTTTSKATHydrophilic
152-180ETDSSADKKSKNKNKNKNKNKQIKSAAATHydrophilic
NLS Segment(s)
PositionSequence
159-189KKSKNKNKNKNKNKQIKSAAATAQKGKKSKK
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR003173  PC4_C  
IPR009044  ssDNA-bd_transcriptional_reg  
IPR045125  Sub1/Tcp4-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0003713  F:transcription coactivator activity  
GO:0060261  P:positive regulation of transcription initiation by RNA polymerase II  
KEGG ssl:SS1G_10618  -  
Pfam View protein in Pfam  
PF02229  PC4  
Amino Acid Sequences MPKRSRAEPVETYDSDGGFVSDDDNTARKSKKSKTTKPTTTSKATSSSSSSTTPSWDLSTGRTPRKIELSDFKGQTLINIREFYEKDGNLLPGKKGISLTIDQYKNFLQSIPQINANLKKKGIEITPEEEEKVEENEDLEEDEDEEEEEAVETDSSADKKSKNKNKNKNKNKQIKSAAATAQKGKKSKKENIEATSDEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.34
3 0.28
4 0.2
5 0.13
6 0.12
7 0.08
8 0.07
9 0.08
10 0.09
11 0.11
12 0.13
13 0.17
14 0.2
15 0.24
16 0.31
17 0.4
18 0.49
19 0.58
20 0.66
21 0.72
22 0.8
23 0.85
24 0.84
25 0.84
26 0.8
27 0.77
28 0.69
29 0.61
30 0.56
31 0.48
32 0.44
33 0.38
34 0.34
35 0.29
36 0.27
37 0.26
38 0.21
39 0.22
40 0.21
41 0.18
42 0.17
43 0.16
44 0.15
45 0.17
46 0.24
47 0.29
48 0.32
49 0.36
50 0.36
51 0.37
52 0.42
53 0.41
54 0.37
55 0.39
56 0.4
57 0.42
58 0.42
59 0.39
60 0.35
61 0.32
62 0.3
63 0.28
64 0.25
65 0.2
66 0.2
67 0.21
68 0.23
69 0.24
70 0.26
71 0.24
72 0.21
73 0.2
74 0.2
75 0.21
76 0.2
77 0.2
78 0.16
79 0.14
80 0.15
81 0.14
82 0.13
83 0.11
84 0.12
85 0.11
86 0.14
87 0.19
88 0.2
89 0.19
90 0.21
91 0.21
92 0.19
93 0.18
94 0.15
95 0.09
96 0.13
97 0.18
98 0.18
99 0.19
100 0.19
101 0.21
102 0.29
103 0.32
104 0.29
105 0.24
106 0.24
107 0.23
108 0.25
109 0.24
110 0.21
111 0.2
112 0.23
113 0.26
114 0.25
115 0.25
116 0.22
117 0.21
118 0.18
119 0.16
120 0.12
121 0.09
122 0.08
123 0.08
124 0.08
125 0.08
126 0.08
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.04
140 0.05
141 0.07
142 0.08
143 0.1
144 0.12
145 0.15
146 0.24
147 0.35
148 0.44
149 0.54
150 0.64
151 0.73
152 0.82
153 0.9
154 0.93
155 0.94
156 0.94
157 0.95
158 0.91
159 0.9
160 0.87
161 0.85
162 0.77
163 0.73
164 0.68
165 0.64
166 0.61
167 0.58
168 0.57
169 0.54
170 0.58
171 0.59
172 0.61
173 0.63
174 0.69
175 0.72
176 0.75
177 0.78
178 0.75
179 0.75
180 0.68