Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074X7R6

Protein Details
Accession A0A074X7R6    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
8-23AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 15, mito_nucl 11.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGAKKQKKKWSKGKVKDKAQHAVILDKATSDRLQKEVQSYRLVTVATLVDRLKINGSLARRSLAELEEQGQIKKVISHSKCLVYTRAVGGTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.48
15 0.39
16 0.32
17 0.25
18 0.18
19 0.16
20 0.14
21 0.14
22 0.14
23 0.14
24 0.15
25 0.17
26 0.18
27 0.24
28 0.26
29 0.28
30 0.28
31 0.27
32 0.25
33 0.24
34 0.23
35 0.16
36 0.13
37 0.11
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.1
47 0.12
48 0.14
49 0.16
50 0.16
51 0.17
52 0.17
53 0.17
54 0.18
55 0.15
56 0.15
57 0.13
58 0.14
59 0.17
60 0.17
61 0.17
62 0.17
63 0.17
64 0.15
65 0.17
66 0.19
67 0.25
68 0.26
69 0.33
70 0.36
71 0.41
72 0.44
73 0.44
74 0.43
75 0.36
76 0.38
77 0.34