Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074X7F5

Protein Details
Accession A0A074X7F5   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
45-70ASLPRTRSNHRQHLRRYPGCRRCSCHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 9, cyto 2, golg 2
Family & Domain DBs
Amino Acid Sequences MMWTSVSVEAFSTFLSEKGSPWNSRDRVCLPRQWTKQTSLKLLDASLPRTRSNHRQHLRRYPGCRRCSCHC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.12
3 0.12
4 0.12
5 0.19
6 0.24
7 0.24
8 0.26
9 0.35
10 0.35
11 0.36
12 0.4
13 0.38
14 0.4
15 0.42
16 0.45
17 0.41
18 0.48
19 0.51
20 0.53
21 0.51
22 0.49
23 0.52
24 0.49
25 0.48
26 0.41
27 0.38
28 0.31
29 0.29
30 0.28
31 0.24
32 0.25
33 0.24
34 0.24
35 0.24
36 0.27
37 0.32
38 0.37
39 0.45
40 0.52
41 0.56
42 0.63
43 0.71
44 0.79
45 0.84
46 0.83
47 0.83
48 0.83
49 0.84
50 0.85
51 0.83