Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074XNH1

Protein Details
Accession A0A074XNH1    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
93-112DPSHRVRKRRSGFLARIRSRBasic
NLS Segment(s)
PositionSequence
97-112RVRKRRSGFLARIRSR
Subcellular Location(s) nucl 14, mito 11, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLFLRCTRQIAQARPALNLSSTSLLQSTLRPLAASQPAQSRTFSLLSARRPTLPTAPTSTLSLNTTLELPTLPASSTTLTLLQARGPKRDTFDPSHRVRKRRSGFLARIRSRNGRNLRSTLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.37
4 0.3
5 0.25
6 0.2
7 0.17
8 0.16
9 0.15
10 0.14
11 0.14
12 0.14
13 0.13
14 0.15
15 0.14
16 0.14
17 0.13
18 0.13
19 0.17
20 0.22
21 0.22
22 0.21
23 0.25
24 0.28
25 0.29
26 0.3
27 0.26
28 0.23
29 0.23
30 0.21
31 0.2
32 0.21
33 0.24
34 0.29
35 0.28
36 0.27
37 0.28
38 0.29
39 0.29
40 0.26
41 0.24
42 0.24
43 0.25
44 0.24
45 0.24
46 0.22
47 0.19
48 0.18
49 0.17
50 0.12
51 0.1
52 0.1
53 0.08
54 0.08
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.07
63 0.08
64 0.08
65 0.08
66 0.09
67 0.1
68 0.1
69 0.12
70 0.17
71 0.18
72 0.21
73 0.23
74 0.24
75 0.28
76 0.34
77 0.37
78 0.39
79 0.46
80 0.5
81 0.54
82 0.63
83 0.65
84 0.67
85 0.68
86 0.71
87 0.7
88 0.72
89 0.74
90 0.74
91 0.76
92 0.79
93 0.84
94 0.79
95 0.78
96 0.74
97 0.74
98 0.69
99 0.69
100 0.68
101 0.66
102 0.66
103 0.65