Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074WYP3

Protein Details
Accession A0A074WYP3    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
8-31NDNSLNPLKLKRRKRDSDSSDSNSHydrophilic
79-101NSERCNLKRYSKHRYGNDNYTIDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MPNSLKDNDNSLNPLKLKRRKRDSDSSDSNSNYDPNYPNKPSDSSDEEKLDEDSSNEDKDSASKEPPIINTYVIYNSTNSERCNLKRYSKHRYGNDNYTID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.5
4 0.57
5 0.63
6 0.71
7 0.75
8 0.81
9 0.85
10 0.83
11 0.83
12 0.82
13 0.77
14 0.72
15 0.64
16 0.57
17 0.46
18 0.39
19 0.3
20 0.24
21 0.21
22 0.2
23 0.26
24 0.27
25 0.28
26 0.29
27 0.31
28 0.3
29 0.31
30 0.33
31 0.3
32 0.31
33 0.31
34 0.29
35 0.27
36 0.26
37 0.22
38 0.15
39 0.12
40 0.12
41 0.12
42 0.12
43 0.11
44 0.1
45 0.1
46 0.11
47 0.14
48 0.13
49 0.13
50 0.14
51 0.16
52 0.17
53 0.19
54 0.2
55 0.18
56 0.17
57 0.16
58 0.16
59 0.16
60 0.15
61 0.14
62 0.13
63 0.13
64 0.17
65 0.19
66 0.19
67 0.21
68 0.26
69 0.28
70 0.34
71 0.38
72 0.43
73 0.5
74 0.57
75 0.64
76 0.68
77 0.75
78 0.76
79 0.81
80 0.8
81 0.79