Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074XP23

Protein Details
Accession A0A074XP23    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
151-172RDEFQARKKRRIEERKEAAKNQBasic
NLS Segment(s)
PositionSequence
157-166RKKRRIEERK
Subcellular Location(s) nucl 10, mito 9.5, cyto_mito 9, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041983  ADA2-like_ZZ  
IPR016827  Ada2/TADA2  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
IPR001005  SANT/Myb  
IPR017884  SANT_dom  
IPR007526  SWIRM  
IPR036388  WH-like_DNA-bd_sf  
IPR000433  Znf_ZZ  
IPR043145  Znf_ZZ_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003713  F:transcription coactivator activity  
GO:0008270  F:zinc ion binding  
GO:0035065  P:regulation of histone acetylation  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00249  Myb_DNA-binding  
PF00569  ZZ  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
PS50090  MYB_LIKE  
PS51293  SANT  
PS50934  SWIRM  
PS01357  ZF_ZZ_1  
PS50135  ZF_ZZ_2  
CDD cd00167  SANT  
cd02335  ZZ_ADA2  
Amino Acid Sequences MGLIKKKTAVRTTEGGIKYICDICSADITATVRIRCADDECSNYDLCVPCFSEGKSSGKHDPATHSFQVIEQHSIPIYVEDWGADEELLLLEGAETYGLGSWADIADHIGGYRTKDEVREHYIETYINSSKFPLPERASPADTTLSESIPRDEFQARKKRRIEERKEAAKNQAIIDSKQKPTSSVPSCHEVQGFMPGRLEFETEYFNEAEEAVQHMQFEPGDGINPTTGELEPEMDLKVTVMDIYNHRLTARVERKKVLFEHNLLEYRKNTAVDKKRTKDERDLSNKMKPFARMMNHSDFETFTTGIEYEHSLRQAIKQLQDWRRMQISDLKTGEKYEVEKAARQARAAATADRFSLPGRVHKPSAQEPPSAASALIGPELPPKPNTSGLQTPPEATSPNPSTNPPPRFPLQAITGVSKMDLYGYNSQDAHLLTENEQEMCKVVRVQPKAYLVMKDAVLKEALRSNGCLKRKNVKEVCRIDTTKAGKLFDFFVWSGWIAKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.44
3 0.37
4 0.33
5 0.31
6 0.3
7 0.26
8 0.19
9 0.19
10 0.18
11 0.21
12 0.21
13 0.17
14 0.17
15 0.19
16 0.22
17 0.25
18 0.24
19 0.22
20 0.22
21 0.24
22 0.23
23 0.25
24 0.26
25 0.27
26 0.31
27 0.33
28 0.34
29 0.32
30 0.3
31 0.31
32 0.27
33 0.23
34 0.23
35 0.21
36 0.2
37 0.22
38 0.23
39 0.25
40 0.27
41 0.31
42 0.32
43 0.36
44 0.41
45 0.44
46 0.47
47 0.43
48 0.47
49 0.48
50 0.52
51 0.47
52 0.42
53 0.37
54 0.35
55 0.39
56 0.33
57 0.31
58 0.24
59 0.24
60 0.23
61 0.23
62 0.21
63 0.15
64 0.13
65 0.1
66 0.09
67 0.08
68 0.09
69 0.09
70 0.09
71 0.08
72 0.07
73 0.06
74 0.06
75 0.06
76 0.05
77 0.04
78 0.04
79 0.04
80 0.04
81 0.03
82 0.03
83 0.03
84 0.03
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.05
91 0.04
92 0.05
93 0.05
94 0.05
95 0.06
96 0.07
97 0.09
98 0.1
99 0.12
100 0.13
101 0.14
102 0.18
103 0.22
104 0.25
105 0.31
106 0.33
107 0.33
108 0.33
109 0.33
110 0.29
111 0.26
112 0.26
113 0.22
114 0.19
115 0.18
116 0.19
117 0.21
118 0.23
119 0.25
120 0.28
121 0.29
122 0.33
123 0.4
124 0.42
125 0.41
126 0.39
127 0.38
128 0.32
129 0.28
130 0.27
131 0.22
132 0.18
133 0.17
134 0.18
135 0.18
136 0.17
137 0.17
138 0.16
139 0.19
140 0.22
141 0.3
142 0.4
143 0.44
144 0.52
145 0.57
146 0.63
147 0.7
148 0.77
149 0.77
150 0.77
151 0.82
152 0.83
153 0.83
154 0.77
155 0.72
156 0.65
157 0.58
158 0.48
159 0.43
160 0.34
161 0.3
162 0.35
163 0.34
164 0.32
165 0.34
166 0.33
167 0.3
168 0.32
169 0.39
170 0.37
171 0.37
172 0.37
173 0.38
174 0.39
175 0.38
176 0.35
177 0.26
178 0.21
179 0.25
180 0.23
181 0.19
182 0.19
183 0.18
184 0.18
185 0.18
186 0.19
187 0.09
188 0.09
189 0.11
190 0.1
191 0.12
192 0.11
193 0.11
194 0.1
195 0.1
196 0.08
197 0.07
198 0.09
199 0.08
200 0.08
201 0.08
202 0.08
203 0.09
204 0.08
205 0.08
206 0.06
207 0.06
208 0.06
209 0.06
210 0.06
211 0.06
212 0.06
213 0.06
214 0.07
215 0.07
216 0.06
217 0.06
218 0.07
219 0.07
220 0.08
221 0.07
222 0.06
223 0.06
224 0.05
225 0.05
226 0.04
227 0.04
228 0.04
229 0.05
230 0.06
231 0.11
232 0.11
233 0.11
234 0.11
235 0.13
236 0.13
237 0.22
238 0.31
239 0.34
240 0.36
241 0.39
242 0.4
243 0.43
244 0.44
245 0.42
246 0.36
247 0.31
248 0.31
249 0.31
250 0.35
251 0.32
252 0.31
253 0.24
254 0.24
255 0.23
256 0.22
257 0.2
258 0.25
259 0.33
260 0.41
261 0.5
262 0.5
263 0.57
264 0.63
265 0.66
266 0.66
267 0.64
268 0.64
269 0.64
270 0.67
271 0.63
272 0.63
273 0.61
274 0.53
275 0.49
276 0.4
277 0.35
278 0.33
279 0.33
280 0.32
281 0.35
282 0.39
283 0.37
284 0.36
285 0.33
286 0.28
287 0.25
288 0.22
289 0.16
290 0.1
291 0.1
292 0.09
293 0.09
294 0.09
295 0.09
296 0.1
297 0.11
298 0.11
299 0.11
300 0.12
301 0.13
302 0.2
303 0.22
304 0.22
305 0.27
306 0.36
307 0.42
308 0.5
309 0.5
310 0.46
311 0.46
312 0.43
313 0.39
314 0.38
315 0.35
316 0.34
317 0.34
318 0.32
319 0.3
320 0.3
321 0.3
322 0.23
323 0.22
324 0.17
325 0.22
326 0.22
327 0.24
328 0.28
329 0.34
330 0.34
331 0.32
332 0.32
333 0.26
334 0.29
335 0.28
336 0.26
337 0.21
338 0.2
339 0.21
340 0.19
341 0.19
342 0.14
343 0.17
344 0.16
345 0.22
346 0.26
347 0.29
348 0.31
349 0.33
350 0.38
351 0.41
352 0.49
353 0.44
354 0.41
355 0.38
356 0.38
357 0.37
358 0.31
359 0.24
360 0.15
361 0.12
362 0.11
363 0.11
364 0.08
365 0.07
366 0.12
367 0.14
368 0.15
369 0.16
370 0.18
371 0.21
372 0.26
373 0.28
374 0.28
375 0.34
376 0.36
377 0.41
378 0.39
379 0.37
380 0.33
381 0.33
382 0.28
383 0.22
384 0.26
385 0.24
386 0.28
387 0.28
388 0.29
389 0.36
390 0.45
391 0.5
392 0.45
393 0.46
394 0.44
395 0.48
396 0.47
397 0.44
398 0.38
399 0.37
400 0.37
401 0.35
402 0.32
403 0.28
404 0.26
405 0.21
406 0.17
407 0.12
408 0.12
409 0.14
410 0.2
411 0.21
412 0.25
413 0.25
414 0.25
415 0.25
416 0.24
417 0.22
418 0.18
419 0.18
420 0.16
421 0.21
422 0.22
423 0.21
424 0.2
425 0.18
426 0.16
427 0.16
428 0.17
429 0.16
430 0.21
431 0.29
432 0.33
433 0.36
434 0.41
435 0.44
436 0.49
437 0.48
438 0.44
439 0.39
440 0.38
441 0.36
442 0.35
443 0.31
444 0.27
445 0.26
446 0.23
447 0.23
448 0.24
449 0.27
450 0.23
451 0.25
452 0.31
453 0.38
454 0.44
455 0.49
456 0.5
457 0.57
458 0.63
459 0.71
460 0.73
461 0.74
462 0.78
463 0.79
464 0.79
465 0.77
466 0.72
467 0.65
468 0.64
469 0.6
470 0.57
471 0.53
472 0.49
473 0.4
474 0.39
475 0.39
476 0.31
477 0.32
478 0.25
479 0.22
480 0.22
481 0.22