Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074XXT8

Protein Details
Accession A0A074XXT8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
67-92ITPIHPRSPSQRRRRPNPRGGQPSSPHydrophilic
NLS Segment(s)
PositionSequence
78-82RRRRP
Subcellular Location(s) plas 16, E.R. 5, extr 2, mito 1, cyto 1, golg 1, vacu 1, cyto_mito 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MADNPRRLSVLGTVILRAALVIAATCLVFAAIPAIIIMFILVAFSPESFANYGFGHETTGIRVDVNITPIHPRSPSQRRRRPNPRGGQPSSPQSPTTPTYTWAGRYNSPPPQRVDTPSAERPAFAWRSPQAYSPVYGDRVNSMPPHLPALSEPEPQIWYDSRRPFIPPLRGPYTSMDPLPPAHPNDRGNSNFSWSPDEPLPPARPEGDTGSPRAEPVRRVTATSMPGEVPMIVDESDEEALPVYERPPEYDDESHSARSLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.18
4 0.14
5 0.09
6 0.05
7 0.04
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.05
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.03
26 0.03
27 0.03
28 0.03
29 0.04
30 0.04
31 0.04
32 0.06
33 0.06
34 0.08
35 0.09
36 0.09
37 0.11
38 0.1
39 0.12
40 0.12
41 0.12
42 0.11
43 0.12
44 0.12
45 0.11
46 0.13
47 0.12
48 0.1
49 0.1
50 0.12
51 0.12
52 0.13
53 0.12
54 0.11
55 0.15
56 0.16
57 0.18
58 0.17
59 0.17
60 0.25
61 0.35
62 0.45
63 0.52
64 0.61
65 0.69
66 0.79
67 0.88
68 0.89
69 0.89
70 0.89
71 0.88
72 0.88
73 0.83
74 0.79
75 0.72
76 0.68
77 0.61
78 0.53
79 0.43
80 0.34
81 0.33
82 0.29
83 0.3
84 0.24
85 0.21
86 0.22
87 0.23
88 0.24
89 0.26
90 0.26
91 0.24
92 0.27
93 0.3
94 0.36
95 0.39
96 0.4
97 0.38
98 0.4
99 0.4
100 0.4
101 0.4
102 0.35
103 0.37
104 0.37
105 0.38
106 0.33
107 0.3
108 0.27
109 0.28
110 0.26
111 0.2
112 0.2
113 0.18
114 0.21
115 0.22
116 0.23
117 0.21
118 0.2
119 0.21
120 0.19
121 0.19
122 0.18
123 0.18
124 0.16
125 0.13
126 0.14
127 0.14
128 0.12
129 0.12
130 0.12
131 0.12
132 0.14
133 0.12
134 0.12
135 0.11
136 0.18
137 0.19
138 0.19
139 0.19
140 0.17
141 0.18
142 0.18
143 0.2
144 0.14
145 0.16
146 0.22
147 0.26
148 0.26
149 0.27
150 0.29
151 0.33
152 0.38
153 0.43
154 0.4
155 0.43
156 0.46
157 0.46
158 0.46
159 0.43
160 0.42
161 0.35
162 0.31
163 0.25
164 0.2
165 0.21
166 0.21
167 0.21
168 0.19
169 0.2
170 0.25
171 0.27
172 0.29
173 0.35
174 0.35
175 0.35
176 0.32
177 0.34
178 0.31
179 0.3
180 0.34
181 0.27
182 0.29
183 0.27
184 0.28
185 0.25
186 0.29
187 0.3
188 0.25
189 0.26
190 0.23
191 0.23
192 0.24
193 0.27
194 0.28
195 0.27
196 0.28
197 0.29
198 0.28
199 0.28
200 0.3
201 0.27
202 0.24
203 0.28
204 0.35
205 0.32
206 0.35
207 0.37
208 0.38
209 0.39
210 0.38
211 0.33
212 0.24
213 0.24
214 0.22
215 0.19
216 0.13
217 0.1
218 0.1
219 0.08
220 0.08
221 0.08
222 0.1
223 0.1
224 0.09
225 0.09
226 0.08
227 0.08
228 0.09
229 0.09
230 0.08
231 0.13
232 0.13
233 0.17
234 0.19
235 0.23
236 0.28
237 0.31
238 0.35
239 0.35
240 0.38
241 0.36