Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074XAJ8

Protein Details
Accession A0A074XAJ8   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
11-33VVETKTNDGKRPKRPTLQTPLSAHydrophilic
NLS Segment(s)
PositionSequence
256-261KGKRRK
Subcellular Location(s) nucl 14, mito 11, cyto_nucl 10
Family & Domain DBs
Amino Acid Sequences MAARSISAPSVVETKTNDGKRPKRPTLQTPLSASYPSEVKSPFPGTPSFIKREENIKTPVTPPVAYLDFLKSMSTGLASPLTTGTSSKFHFSDKVPSEVIEETDETSPDVTPEIVQPPLSRTNSTCSESSTTSAISSSTESVHSVSSTISESKRKIRPQSPRVIIPPSPFAKPRSAKLPRGIQVPLSPMSPANLRSPMSARPHHEPHSASALSGTPWSATYSPTEAESSTTSKMSVRQVVTRTVTYSRTPLDPAPKGKRRKIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.32
3 0.36
4 0.42
5 0.48
6 0.56
7 0.64
8 0.72
9 0.75
10 0.76
11 0.8
12 0.83
13 0.83
14 0.83
15 0.79
16 0.74
17 0.69
18 0.61
19 0.53
20 0.44
21 0.35
22 0.28
23 0.23
24 0.21
25 0.18
26 0.18
27 0.22
28 0.26
29 0.25
30 0.26
31 0.26
32 0.26
33 0.34
34 0.37
35 0.37
36 0.35
37 0.37
38 0.37
39 0.43
40 0.44
41 0.41
42 0.4
43 0.38
44 0.37
45 0.36
46 0.39
47 0.35
48 0.3
49 0.25
50 0.25
51 0.24
52 0.22
53 0.22
54 0.19
55 0.17
56 0.17
57 0.16
58 0.11
59 0.1
60 0.1
61 0.09
62 0.07
63 0.07
64 0.08
65 0.08
66 0.08
67 0.08
68 0.09
69 0.08
70 0.09
71 0.09
72 0.11
73 0.12
74 0.15
75 0.15
76 0.16
77 0.19
78 0.2
79 0.28
80 0.27
81 0.3
82 0.27
83 0.27
84 0.28
85 0.25
86 0.24
87 0.16
88 0.13
89 0.11
90 0.11
91 0.11
92 0.09
93 0.09
94 0.08
95 0.07
96 0.07
97 0.05
98 0.05
99 0.07
100 0.08
101 0.08
102 0.09
103 0.09
104 0.12
105 0.18
106 0.19
107 0.18
108 0.18
109 0.22
110 0.25
111 0.28
112 0.25
113 0.2
114 0.22
115 0.21
116 0.21
117 0.17
118 0.14
119 0.11
120 0.11
121 0.09
122 0.07
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.08
129 0.08
130 0.07
131 0.07
132 0.06
133 0.06
134 0.07
135 0.09
136 0.11
137 0.14
138 0.17
139 0.24
140 0.31
141 0.36
142 0.43
143 0.49
144 0.58
145 0.62
146 0.7
147 0.67
148 0.65
149 0.63
150 0.59
151 0.54
152 0.45
153 0.44
154 0.35
155 0.34
156 0.31
157 0.31
158 0.34
159 0.35
160 0.35
161 0.39
162 0.44
163 0.47
164 0.52
165 0.58
166 0.52
167 0.53
168 0.51
169 0.42
170 0.37
171 0.35
172 0.29
173 0.21
174 0.18
175 0.15
176 0.15
177 0.16
178 0.16
179 0.16
180 0.18
181 0.19
182 0.2
183 0.22
184 0.27
185 0.32
186 0.35
187 0.37
188 0.4
189 0.46
190 0.48
191 0.51
192 0.46
193 0.43
194 0.45
195 0.4
196 0.32
197 0.28
198 0.24
199 0.19
200 0.18
201 0.15
202 0.08
203 0.09
204 0.12
205 0.11
206 0.11
207 0.14
208 0.15
209 0.16
210 0.17
211 0.17
212 0.15
213 0.17
214 0.18
215 0.19
216 0.18
217 0.18
218 0.17
219 0.18
220 0.22
221 0.26
222 0.3
223 0.3
224 0.34
225 0.36
226 0.43
227 0.45
228 0.42
229 0.4
230 0.36
231 0.36
232 0.33
233 0.35
234 0.31
235 0.29
236 0.31
237 0.33
238 0.39
239 0.43
240 0.5
241 0.56
242 0.62
243 0.69
244 0.74