Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074XW65

Protein Details
Accession A0A074XW65    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
97-124MATKIEKASRQQRKQRKNRMKTLTGTAKHydrophilic
NLS Segment(s)
PositionSequence
103-134KASRQQRKQRKNRMKTLTGTAKVKGAKTKKDK
Subcellular Location(s) mito 17, nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADAQVTLRTRKFIRNPLLARKQMVVDVLHPNRPNVSKDELRQKLSELYKADKDQVSVFGFRTQYGGGKSTGFALIYDSNEAMKKFEPHYRLVRVGMATKIEKASRQQRKQRKNRMKTLTGTAKVKGAKTKKDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.6
3 0.65
4 0.71
5 0.78
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.22
14 0.29
15 0.29
16 0.33
17 0.32
18 0.32
19 0.33
20 0.34
21 0.33
22 0.28
23 0.32
24 0.31
25 0.36
26 0.46
27 0.47
28 0.47
29 0.45
30 0.43
31 0.43
32 0.4
33 0.4
34 0.31
35 0.31
36 0.32
37 0.32
38 0.34
39 0.27
40 0.26
41 0.22
42 0.23
43 0.21
44 0.18
45 0.17
46 0.17
47 0.17
48 0.16
49 0.16
50 0.12
51 0.12
52 0.12
53 0.13
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.07
61 0.08
62 0.08
63 0.09
64 0.09
65 0.09
66 0.09
67 0.1
68 0.1
69 0.1
70 0.1
71 0.12
72 0.14
73 0.2
74 0.22
75 0.26
76 0.32
77 0.35
78 0.36
79 0.34
80 0.34
81 0.3
82 0.3
83 0.26
84 0.23
85 0.2
86 0.19
87 0.21
88 0.19
89 0.2
90 0.26
91 0.35
92 0.42
93 0.51
94 0.6
95 0.68
96 0.78
97 0.87
98 0.91
99 0.92
100 0.91
101 0.92
102 0.91
103 0.87
104 0.81
105 0.81
106 0.79
107 0.75
108 0.68
109 0.59
110 0.55
111 0.51
112 0.5
113 0.49
114 0.47