Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074XR94

Protein Details
Accession A0A074XR94    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
45-65QSPTMARRKSKRKVPKEQLAMHydrophilic
NLS Segment(s)
PositionSequence
51-60RRKSKRKVPK
Subcellular Location(s) nucl 18.5, cyto_nucl 14.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038291  SAP30_C_sf  
Amino Acid Sequences MQFTWAQEDLSLLQEYRAAHRMETPSAFNSIRNQFLLTNPGIGRQSPTMARRKSKRKVPKEQLAMAVRKNFNDAAVNEIDVMVDLLYKVRNQDKAFRLRSAPNKSNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.17
4 0.21
5 0.19
6 0.18
7 0.24
8 0.27
9 0.27
10 0.29
11 0.27
12 0.23
13 0.27
14 0.27
15 0.23
16 0.27
17 0.27
18 0.27
19 0.25
20 0.25
21 0.21
22 0.22
23 0.24
24 0.18
25 0.18
26 0.16
27 0.18
28 0.17
29 0.16
30 0.17
31 0.13
32 0.15
33 0.15
34 0.2
35 0.26
36 0.3
37 0.37
38 0.43
39 0.52
40 0.58
41 0.64
42 0.7
43 0.72
44 0.79
45 0.81
46 0.83
47 0.79
48 0.75
49 0.73
50 0.67
51 0.6
52 0.51
53 0.48
54 0.4
55 0.33
56 0.33
57 0.25
58 0.21
59 0.22
60 0.2
61 0.17
62 0.17
63 0.17
64 0.15
65 0.14
66 0.13
67 0.09
68 0.09
69 0.04
70 0.04
71 0.03
72 0.05
73 0.06
74 0.07
75 0.11
76 0.16
77 0.23
78 0.25
79 0.35
80 0.42
81 0.51
82 0.55
83 0.55
84 0.55
85 0.57
86 0.64
87 0.65