Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074Y1X7

Protein Details
Accession A0A074Y1X7    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
119-148ERDREKTEKNRVKREKARLRKEKGKAGKNKBasic
NLS Segment(s)
PositionSequence
113-152RKKEQEERDREKTEKNRVKREKARLRKEKGKAGKNKEEGG
Subcellular Location(s) nucl 19, mito_nucl 12.833, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSENIPESIPTHRDPRSGQATKKRALSPRSKQSAHLEHLFAFPEKAITSSTSSKTSSSSLPPEIVANVQGSSAGAGSGEFHVYKASRRREYERLRAMDEEKEKEERDGEFEMRKKEQEERDREKTEKNRVKREKARLRKEKGKAGKNKEEGGEGESKGDVVQKKEKFKPNVAVQRNGLNGEAEVGPAVEEQGIVFLDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.42
3 0.47
4 0.51
5 0.56
6 0.6
7 0.65
8 0.65
9 0.7
10 0.68
11 0.66
12 0.67
13 0.69
14 0.69
15 0.72
16 0.76
17 0.7
18 0.68
19 0.7
20 0.69
21 0.64
22 0.58
23 0.49
24 0.42
25 0.42
26 0.38
27 0.3
28 0.22
29 0.16
30 0.13
31 0.11
32 0.11
33 0.1
34 0.11
35 0.14
36 0.18
37 0.21
38 0.23
39 0.23
40 0.23
41 0.24
42 0.24
43 0.22
44 0.22
45 0.24
46 0.22
47 0.22
48 0.22
49 0.21
50 0.19
51 0.17
52 0.14
53 0.1
54 0.09
55 0.08
56 0.07
57 0.06
58 0.06
59 0.05
60 0.04
61 0.03
62 0.03
63 0.04
64 0.04
65 0.05
66 0.05
67 0.05
68 0.07
69 0.07
70 0.12
71 0.19
72 0.27
73 0.31
74 0.35
75 0.41
76 0.5
77 0.57
78 0.62
79 0.62
80 0.57
81 0.53
82 0.51
83 0.47
84 0.43
85 0.38
86 0.31
87 0.25
88 0.25
89 0.23
90 0.22
91 0.21
92 0.16
93 0.16
94 0.16
95 0.16
96 0.18
97 0.21
98 0.24
99 0.24
100 0.25
101 0.24
102 0.28
103 0.35
104 0.4
105 0.46
106 0.51
107 0.57
108 0.61
109 0.61
110 0.62
111 0.61
112 0.63
113 0.63
114 0.62
115 0.65
116 0.7
117 0.78
118 0.79
119 0.83
120 0.83
121 0.85
122 0.88
123 0.87
124 0.87
125 0.87
126 0.84
127 0.83
128 0.82
129 0.81
130 0.79
131 0.79
132 0.8
133 0.75
134 0.71
135 0.62
136 0.55
137 0.47
138 0.41
139 0.36
140 0.26
141 0.22
142 0.18
143 0.17
144 0.15
145 0.19
146 0.17
147 0.18
148 0.27
149 0.32
150 0.41
151 0.49
152 0.58
153 0.6
154 0.64
155 0.69
156 0.71
157 0.75
158 0.73
159 0.71
160 0.64
161 0.63
162 0.58
163 0.5
164 0.4
165 0.3
166 0.24
167 0.2
168 0.18
169 0.12
170 0.1
171 0.09
172 0.08
173 0.07
174 0.08
175 0.05
176 0.05
177 0.05
178 0.06
179 0.06