Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074X9H8

Protein Details
Accession A0A074X9H8   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
47-67LFSCLSAKRRRRRGANPYYGTHydrophilic
NLS Segment(s)
PositionSequence
55-59RRRRR
Subcellular Location(s) nucl 7mito 7mito_nucl 7, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020999  Chitin_synth_reg_RCR  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF12273  RCR  
Amino Acid Sequences MPILEARQYYGYYNRCYGNNCNSTWNRWGRWVLLACIIAVFFILFFLFSCLSAKRRRRRGANPYYGTGWTVRHGTPTYNQNAPQTAQPYYANNTTAPHYNNSNNPPPAYSPPPNTTNYHGGNNIELQQPQAAYNGNYAPPKDPPPARY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.39
4 0.42
5 0.45
6 0.45
7 0.42
8 0.47
9 0.47
10 0.49
11 0.52
12 0.52
13 0.44
14 0.44
15 0.45
16 0.38
17 0.43
18 0.4
19 0.34
20 0.31
21 0.3
22 0.24
23 0.22
24 0.19
25 0.12
26 0.1
27 0.08
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.05
34 0.05
35 0.06
36 0.08
37 0.09
38 0.13
39 0.22
40 0.31
41 0.39
42 0.49
43 0.56
44 0.64
45 0.72
46 0.8
47 0.81
48 0.83
49 0.77
50 0.69
51 0.63
52 0.54
53 0.45
54 0.35
55 0.25
56 0.16
57 0.15
58 0.12
59 0.13
60 0.13
61 0.13
62 0.16
63 0.2
64 0.22
65 0.22
66 0.24
67 0.23
68 0.24
69 0.24
70 0.22
71 0.2
72 0.17
73 0.17
74 0.17
75 0.17
76 0.19
77 0.2
78 0.19
79 0.17
80 0.17
81 0.17
82 0.19
83 0.19
84 0.18
85 0.2
86 0.22
87 0.28
88 0.32
89 0.38
90 0.36
91 0.35
92 0.34
93 0.34
94 0.36
95 0.38
96 0.37
97 0.36
98 0.38
99 0.42
100 0.44
101 0.43
102 0.43
103 0.43
104 0.41
105 0.39
106 0.36
107 0.33
108 0.32
109 0.31
110 0.28
111 0.24
112 0.2
113 0.18
114 0.18
115 0.17
116 0.16
117 0.16
118 0.15
119 0.13
120 0.16
121 0.17
122 0.2
123 0.22
124 0.23
125 0.24
126 0.27
127 0.31
128 0.36