Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EDW9

Protein Details
Accession A7EDW9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
51-77DDGKCKSCVKKQEKAKKKEKNGDAGGCBasic
NLS Segment(s)
PositionSequence
62-69QEKAKKKE
Subcellular Location(s) nucl 10, mito 8, cyto 7
Family & Domain DBs
KEGG ssl:SS1G_03509  -  
Amino Acid Sequences MSSPDTPGNIEGLLRRKGDLNPMNWGFKVDDKILDHPKIGLIKTDVSKPKDDGKCKSCVKKQEKAKKKEKNGDAGGCVVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.25
4 0.26
5 0.35
6 0.36
7 0.32
8 0.37
9 0.39
10 0.4
11 0.37
12 0.38
13 0.29
14 0.26
15 0.27
16 0.19
17 0.19
18 0.19
19 0.25
20 0.29
21 0.28
22 0.26
23 0.23
24 0.24
25 0.22
26 0.2
27 0.16
28 0.12
29 0.13
30 0.14
31 0.21
32 0.24
33 0.25
34 0.27
35 0.28
36 0.36
37 0.4
38 0.45
39 0.47
40 0.45
41 0.51
42 0.56
43 0.63
44 0.6
45 0.64
46 0.66
47 0.67
48 0.74
49 0.76
50 0.8
51 0.81
52 0.86
53 0.86
54 0.89
55 0.9
56 0.87
57 0.86
58 0.84
59 0.79
60 0.71