Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074XID5

Protein Details
Accession A0A074XID5    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
45-73LRCGLNEPKRSRKLRRKPRVLNSYLNRGRHydrophilic
NLS Segment(s)
PositionSequence
52-63PKRSRKLRRKPR
Subcellular Location(s) mito 12.5, nucl 11, cyto_mito 7.5, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MCLMTRRRCERLCFCFLPWAGHEAESRCPERLSSVSGSGRTGGGLRCGLNEPKRSRKLRRKPRVLNSYLNRGRHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.53
4 0.48
5 0.39
6 0.34
7 0.26
8 0.25
9 0.25
10 0.19
11 0.23
12 0.24
13 0.24
14 0.23
15 0.22
16 0.2
17 0.21
18 0.21
19 0.19
20 0.17
21 0.19
22 0.2
23 0.2
24 0.2
25 0.18
26 0.16
27 0.13
28 0.12
29 0.08
30 0.09
31 0.09
32 0.09
33 0.1
34 0.13
35 0.18
36 0.23
37 0.31
38 0.35
39 0.44
40 0.53
41 0.6
42 0.68
43 0.74
44 0.8
45 0.83
46 0.88
47 0.89
48 0.91
49 0.94
50 0.93
51 0.88
52 0.87
53 0.82
54 0.82
55 0.78