Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074XE82

Protein Details
Accession A0A074XE82    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-44EDVSTSPTRPWRRRKVRNRKTKWKTYSSRDHydrophilic
NLS Segment(s)
PositionSequence
23-37RPWRRRKVRNRKTKW
Subcellular Location(s) nucl 14, mito 9, cyto 3
Family & Domain DBs
Amino Acid Sequences MVRLIKITTGSICIEDVSTSPTRPWRRRKVRNRKTKWKTYSSRDSHVVTHRSTNLPFNCLCMAERTGCPVFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.1
4 0.13
5 0.13
6 0.13
7 0.14
8 0.23
9 0.32
10 0.4
11 0.5
12 0.56
13 0.66
14 0.76
15 0.86
16 0.89
17 0.9
18 0.93
19 0.93
20 0.93
21 0.91
22 0.9
23 0.86
24 0.84
25 0.81
26 0.78
27 0.78
28 0.72
29 0.68
30 0.61
31 0.56
32 0.51
33 0.5
34 0.46
35 0.37
36 0.36
37 0.35
38 0.34
39 0.33
40 0.37
41 0.32
42 0.31
43 0.3
44 0.29
45 0.27
46 0.25
47 0.24
48 0.2
49 0.21
50 0.22
51 0.22
52 0.26