Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074YQJ1

Protein Details
Accession A0A074YQJ1   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
241-261TKTNKQTPRSSVKRRKRTSTSHydrophilic
358-389EAQTPKKNKPPAKTPLHRKEKHAPRPAAKDLDBasic
429-448SMDRRKEYRAWKRDILQRCAHydrophilic
NLS Segment(s)
PositionSequence
362-384PKKNKPPAKTPLHRKEKHAPRPA
Subcellular Location(s) cyto_nucl 11, nucl 10.5, cyto 10.5, pero 2, mito 1, extr 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR008721  ORC6  
Gene Ontology GO:0005664  C:nuclear origin of replication recognition complex  
GO:0003677  F:DNA binding  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF05460  ORC6  
Amino Acid Sequences MPSPMEQALITLVPTLNSLPQELIDLSTSLLAQSRNKAASLKPDEEIGRTYACAHIAVERLRNRLDIDKVVARPPVAPRIYKKLYGYLDAALSVPATPRTNRLKDVGTVGTPGSGRGRRSALGTPVGTPSKTPAKSVRSAGVTPLKTPISAAKSVGSVTASGRRTRSAAKAPEEEIVIADSEEDIQKQIVQEQEKGYNLPTQVPPLIMSVCDALDVPQASTHVLAALSAILQLRGYNDAETKTNKQTPRSSVKRRKRTSTSAEEEPTSQEDDKAITPTSLPALLAAIALITTFTLRNTVIDGTAYAAARSSAIQALDPHAPISAEVDAFLHASKTEGWLELPWFTAVKAAATTTAIPEAQTPKKNKPPAKTPLHRKEKHAPRPAAKDLDMDTVMEDADAEAEEEDADKPGAGLRSGLGTMFQDSVDWLSMDRRKEYRAWKRDILQRCAEIESRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.13
5 0.14
6 0.13
7 0.13
8 0.15
9 0.15
10 0.15
11 0.13
12 0.13
13 0.12
14 0.12
15 0.12
16 0.1
17 0.12
18 0.13
19 0.15
20 0.2
21 0.26
22 0.27
23 0.28
24 0.31
25 0.31
26 0.38
27 0.43
28 0.41
29 0.36
30 0.39
31 0.39
32 0.39
33 0.38
34 0.3
35 0.23
36 0.2
37 0.21
38 0.18
39 0.17
40 0.16
41 0.14
42 0.15
43 0.19
44 0.22
45 0.28
46 0.31
47 0.34
48 0.34
49 0.35
50 0.35
51 0.36
52 0.37
53 0.32
54 0.33
55 0.36
56 0.37
57 0.39
58 0.38
59 0.33
60 0.32
61 0.32
62 0.36
63 0.33
64 0.36
65 0.37
66 0.45
67 0.49
68 0.5
69 0.48
70 0.47
71 0.46
72 0.45
73 0.42
74 0.34
75 0.3
76 0.25
77 0.23
78 0.15
79 0.13
80 0.1
81 0.09
82 0.1
83 0.12
84 0.13
85 0.2
86 0.29
87 0.32
88 0.35
89 0.37
90 0.37
91 0.37
92 0.41
93 0.36
94 0.28
95 0.26
96 0.23
97 0.21
98 0.18
99 0.17
100 0.19
101 0.19
102 0.2
103 0.22
104 0.24
105 0.23
106 0.27
107 0.3
108 0.27
109 0.29
110 0.29
111 0.27
112 0.29
113 0.3
114 0.26
115 0.22
116 0.23
117 0.26
118 0.26
119 0.28
120 0.31
121 0.35
122 0.39
123 0.42
124 0.43
125 0.38
126 0.37
127 0.4
128 0.4
129 0.35
130 0.31
131 0.32
132 0.28
133 0.24
134 0.24
135 0.24
136 0.2
137 0.21
138 0.21
139 0.18
140 0.18
141 0.18
142 0.18
143 0.13
144 0.1
145 0.1
146 0.16
147 0.17
148 0.19
149 0.2
150 0.2
151 0.22
152 0.25
153 0.29
154 0.3
155 0.35
156 0.37
157 0.39
158 0.39
159 0.39
160 0.36
161 0.3
162 0.22
163 0.16
164 0.11
165 0.08
166 0.06
167 0.05
168 0.05
169 0.05
170 0.05
171 0.05
172 0.05
173 0.06
174 0.06
175 0.09
176 0.12
177 0.13
178 0.16
179 0.18
180 0.21
181 0.2
182 0.21
183 0.19
184 0.18
185 0.17
186 0.17
187 0.16
188 0.15
189 0.15
190 0.15
191 0.14
192 0.12
193 0.12
194 0.09
195 0.09
196 0.07
197 0.07
198 0.06
199 0.06
200 0.05
201 0.07
202 0.07
203 0.06
204 0.06
205 0.07
206 0.07
207 0.07
208 0.06
209 0.05
210 0.04
211 0.04
212 0.04
213 0.04
214 0.03
215 0.04
216 0.04
217 0.03
218 0.04
219 0.04
220 0.04
221 0.06
222 0.07
223 0.07
224 0.08
225 0.09
226 0.12
227 0.15
228 0.18
229 0.21
230 0.27
231 0.29
232 0.33
233 0.37
234 0.42
235 0.49
236 0.54
237 0.6
238 0.65
239 0.74
240 0.79
241 0.8
242 0.82
243 0.79
244 0.78
245 0.76
246 0.74
247 0.7
248 0.64
249 0.6
250 0.52
251 0.46
252 0.38
253 0.31
254 0.24
255 0.18
256 0.13
257 0.12
258 0.12
259 0.12
260 0.13
261 0.11
262 0.09
263 0.09
264 0.09
265 0.1
266 0.09
267 0.08
268 0.06
269 0.06
270 0.06
271 0.06
272 0.05
273 0.03
274 0.03
275 0.03
276 0.03
277 0.02
278 0.03
279 0.03
280 0.04
281 0.05
282 0.06
283 0.06
284 0.08
285 0.08
286 0.08
287 0.08
288 0.08
289 0.08
290 0.11
291 0.1
292 0.09
293 0.08
294 0.08
295 0.08
296 0.08
297 0.08
298 0.07
299 0.07
300 0.09
301 0.09
302 0.12
303 0.14
304 0.14
305 0.13
306 0.11
307 0.11
308 0.1
309 0.11
310 0.09
311 0.07
312 0.07
313 0.08
314 0.08
315 0.08
316 0.08
317 0.06
318 0.05
319 0.06
320 0.06
321 0.09
322 0.09
323 0.09
324 0.1
325 0.11
326 0.13
327 0.12
328 0.13
329 0.11
330 0.11
331 0.1
332 0.12
333 0.1
334 0.1
335 0.1
336 0.09
337 0.09
338 0.1
339 0.1
340 0.09
341 0.11
342 0.1
343 0.1
344 0.13
345 0.19
346 0.25
347 0.32
348 0.36
349 0.43
350 0.53
351 0.62
352 0.66
353 0.67
354 0.7
355 0.73
356 0.79
357 0.8
358 0.82
359 0.83
360 0.88
361 0.84
362 0.82
363 0.82
364 0.83
365 0.83
366 0.82
367 0.8
368 0.77
369 0.81
370 0.81
371 0.76
372 0.66
373 0.59
374 0.51
375 0.47
376 0.39
377 0.31
378 0.24
379 0.18
380 0.17
381 0.13
382 0.1
383 0.05
384 0.05
385 0.05
386 0.05
387 0.05
388 0.05
389 0.05
390 0.06
391 0.07
392 0.07
393 0.07
394 0.07
395 0.07
396 0.1
397 0.12
398 0.11
399 0.11
400 0.11
401 0.13
402 0.13
403 0.13
404 0.11
405 0.11
406 0.13
407 0.13
408 0.12
409 0.1
410 0.1
411 0.12
412 0.12
413 0.11
414 0.1
415 0.17
416 0.22
417 0.25
418 0.3
419 0.32
420 0.35
421 0.42
422 0.53
423 0.56
424 0.62
425 0.66
426 0.68
427 0.74
428 0.79
429 0.81
430 0.78
431 0.74
432 0.69
433 0.63
434 0.59