Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074X720

Protein Details
Accession A0A074X720    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
117-148ALKAEREKKKKASKNKKARRKYRKLEDGKEVEBasic
NLS Segment(s)
PositionSequence
118-140LKAEREKKKKASKNKKARRKYRK
Subcellular Location(s) mito 19, mito_nucl 13.333, cyto_mito 10.833, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MLSLRRVFLSARPIPAAPPSALRACCFTTTTPLPQKPLPPRPTIEESDITEAFLKGTGPGGQKINKTSSAVQLKHLPTGIVIKCQETRSRSQNRKIARRILAERIELLTLGDDSRAALKAEREKKKKASKNKKARRKYRKLEDGKEVEVDEEDEGEDEVPEIRDIEVRQDGVEEPPAPAAHTVQSHDKPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.34
4 0.26
5 0.24
6 0.25
7 0.28
8 0.29
9 0.29
10 0.29
11 0.28
12 0.29
13 0.27
14 0.24
15 0.26
16 0.28
17 0.36
18 0.42
19 0.42
20 0.44
21 0.45
22 0.53
23 0.55
24 0.62
25 0.58
26 0.54
27 0.54
28 0.57
29 0.6
30 0.55
31 0.5
32 0.43
33 0.39
34 0.4
35 0.36
36 0.3
37 0.25
38 0.21
39 0.17
40 0.13
41 0.11
42 0.06
43 0.08
44 0.11
45 0.11
46 0.14
47 0.17
48 0.21
49 0.23
50 0.26
51 0.27
52 0.25
53 0.27
54 0.26
55 0.3
56 0.35
57 0.34
58 0.33
59 0.37
60 0.36
61 0.35
62 0.33
63 0.25
64 0.17
65 0.23
66 0.21
67 0.18
68 0.18
69 0.18
70 0.21
71 0.23
72 0.26
73 0.23
74 0.27
75 0.32
76 0.41
77 0.47
78 0.52
79 0.55
80 0.59
81 0.65
82 0.65
83 0.64
84 0.59
85 0.57
86 0.53
87 0.55
88 0.49
89 0.41
90 0.36
91 0.29
92 0.25
93 0.19
94 0.15
95 0.09
96 0.06
97 0.06
98 0.05
99 0.04
100 0.04
101 0.05
102 0.06
103 0.06
104 0.07
105 0.1
106 0.19
107 0.29
108 0.39
109 0.43
110 0.49
111 0.58
112 0.67
113 0.73
114 0.75
115 0.77
116 0.79
117 0.85
118 0.9
119 0.91
120 0.91
121 0.94
122 0.94
123 0.93
124 0.93
125 0.93
126 0.93
127 0.92
128 0.88
129 0.86
130 0.8
131 0.71
132 0.62
133 0.51
134 0.4
135 0.31
136 0.25
137 0.15
138 0.11
139 0.09
140 0.07
141 0.07
142 0.07
143 0.06
144 0.05
145 0.06
146 0.07
147 0.07
148 0.07
149 0.07
150 0.1
151 0.11
152 0.16
153 0.18
154 0.17
155 0.17
156 0.18
157 0.19
158 0.18
159 0.22
160 0.18
161 0.15
162 0.18
163 0.18
164 0.17
165 0.17
166 0.16
167 0.16
168 0.18
169 0.21
170 0.27