Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074XIA4

Protein Details
Accession A0A074XIA4    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
160-191NRGSRSSRGRDEERRRRRRRRGVVFRPTQSTQBasic
NLS Segment(s)
PositionSequence
164-181RSSRGRDEERRRRRRRRG
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
Amino Acid Sequences MTSSSLAFSGAASSEIAASSTYRRAMSKQASRHLYNYRLNTSEPQNAYSSTSTSSHHRKSTRTHQTGLTQNHHASRQLTTAIAPPRRHPGVELPEASASQHQAMYLEYLDLVAAGKITDPASPPDYQNYGIRDGEEEVPEFAPPSYEQVLGENGGYEDVNRGSRSSRGRDEERRRRRRRRGVVFRPTQSTQPSPATQPSPTPAIQELQLIRITTPIPTTLPPRPKSVNFFSRLGNKFRVSRAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.08
4 0.07
5 0.08
6 0.1
7 0.13
8 0.15
9 0.17
10 0.18
11 0.2
12 0.29
13 0.38
14 0.43
15 0.48
16 0.55
17 0.6
18 0.61
19 0.65
20 0.63
21 0.61
22 0.6
23 0.58
24 0.54
25 0.49
26 0.48
27 0.47
28 0.45
29 0.45
30 0.4
31 0.36
32 0.33
33 0.32
34 0.33
35 0.29
36 0.25
37 0.19
38 0.19
39 0.18
40 0.24
41 0.31
42 0.34
43 0.4
44 0.42
45 0.44
46 0.51
47 0.61
48 0.65
49 0.61
50 0.59
51 0.56
52 0.59
53 0.63
54 0.61
55 0.55
56 0.48
57 0.45
58 0.45
59 0.42
60 0.37
61 0.3
62 0.25
63 0.22
64 0.19
65 0.17
66 0.15
67 0.19
68 0.24
69 0.29
70 0.28
71 0.28
72 0.34
73 0.36
74 0.35
75 0.31
76 0.32
77 0.33
78 0.36
79 0.35
80 0.3
81 0.29
82 0.29
83 0.27
84 0.2
85 0.14
86 0.1
87 0.09
88 0.07
89 0.07
90 0.07
91 0.07
92 0.07
93 0.06
94 0.05
95 0.05
96 0.04
97 0.04
98 0.04
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.04
105 0.05
106 0.06
107 0.08
108 0.1
109 0.11
110 0.12
111 0.13
112 0.14
113 0.15
114 0.18
115 0.17
116 0.18
117 0.17
118 0.17
119 0.15
120 0.16
121 0.16
122 0.14
123 0.12
124 0.1
125 0.1
126 0.1
127 0.1
128 0.08
129 0.07
130 0.07
131 0.09
132 0.1
133 0.1
134 0.1
135 0.11
136 0.12
137 0.12
138 0.11
139 0.08
140 0.07
141 0.07
142 0.06
143 0.05
144 0.06
145 0.07
146 0.09
147 0.09
148 0.09
149 0.1
150 0.16
151 0.21
152 0.25
153 0.31
154 0.36
155 0.43
156 0.53
157 0.63
158 0.69
159 0.75
160 0.81
161 0.85
162 0.89
163 0.93
164 0.94
165 0.94
166 0.94
167 0.94
168 0.94
169 0.94
170 0.92
171 0.85
172 0.8
173 0.71
174 0.64
175 0.58
176 0.5
177 0.44
178 0.4
179 0.37
180 0.34
181 0.37
182 0.36
183 0.32
184 0.32
185 0.3
186 0.29
187 0.27
188 0.27
189 0.24
190 0.22
191 0.22
192 0.24
193 0.22
194 0.2
195 0.22
196 0.2
197 0.18
198 0.18
199 0.18
200 0.14
201 0.15
202 0.13
203 0.13
204 0.15
205 0.21
206 0.29
207 0.38
208 0.39
209 0.45
210 0.5
211 0.54
212 0.59
213 0.62
214 0.63
215 0.58
216 0.58
217 0.57
218 0.6
219 0.59
220 0.57
221 0.54
222 0.5
223 0.5