Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074XQC9

Protein Details
Accession A0A074XQC9   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-30RGKQTKAACIPCRKRKSKCDGIRPSCKSCVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences RGKQTKAACIPCRKRKSKCDGIRPSCKSCVGKTTPCEYSVNPGVTQQQAVKNQLDAYKHVLNLLRQGNEAECEVLIKQLKAHELLADAVGNIMQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.87
4 0.87
5 0.86
6 0.87
7 0.87
8 0.87
9 0.89
10 0.85
11 0.8
12 0.73
13 0.69
14 0.61
15 0.51
16 0.5
17 0.46
18 0.45
19 0.44
20 0.46
21 0.41
22 0.4
23 0.4
24 0.32
25 0.32
26 0.31
27 0.28
28 0.23
29 0.22
30 0.22
31 0.2
32 0.21
33 0.17
34 0.17
35 0.18
36 0.2
37 0.2
38 0.18
39 0.2
40 0.21
41 0.2
42 0.17
43 0.21
44 0.2
45 0.2
46 0.21
47 0.22
48 0.2
49 0.26
50 0.28
51 0.23
52 0.21
53 0.22
54 0.2
55 0.2
56 0.2
57 0.13
58 0.09
59 0.09
60 0.09
61 0.13
62 0.14
63 0.12
64 0.14
65 0.16
66 0.18
67 0.19
68 0.2
69 0.17
70 0.16
71 0.17
72 0.17
73 0.14
74 0.12