Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074YEA3

Protein Details
Accession A0A074YEA3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
13-40TACRWAAQRSKGRRRAKWKGRPELCKMIHydrophilic
NLS Segment(s)
PositionSequence
21-33RSKGRRRAKWKGR
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MLVMTGCRVLNATACRWAAQRSKGRRRAKWKGRPELCKMILPVVLWRLAVKESSSRACQGNLAPVSLPHTIPRRRQPWRVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.25
4 0.3
5 0.31
6 0.37
7 0.44
8 0.49
9 0.59
10 0.68
11 0.76
12 0.79
13 0.83
14 0.85
15 0.87
16 0.87
17 0.86
18 0.87
19 0.86
20 0.84
21 0.81
22 0.79
23 0.7
24 0.62
25 0.52
26 0.42
27 0.35
28 0.28
29 0.22
30 0.14
31 0.12
32 0.1
33 0.09
34 0.09
35 0.08
36 0.09
37 0.08
38 0.1
39 0.13
40 0.17
41 0.18
42 0.2
43 0.21
44 0.21
45 0.22
46 0.2
47 0.25
48 0.23
49 0.22
50 0.19
51 0.19
52 0.22
53 0.22
54 0.21
55 0.18
56 0.26
57 0.32
58 0.41
59 0.5
60 0.56
61 0.63