Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7ERJ8

Protein Details
Accession A7ERJ8    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
7-33QLPIHKCMPLKKKHRASRRKKFEEEAEBasic
NLS Segment(s)
PositionSequence
17-27KKKHRASRRKK
Subcellular Location(s) nucl 18, mito 9, cyto_nucl 9
Family & Domain DBs
KEGG ssl:SS1G_07952  -  
Amino Acid Sequences MSSKSSQLPIHKCMPLKKKHRASRRKKFEEEAEEDKVVANRVYHKVGGSGGGEEDNEAKELEQRRARLIEENRAAEKEEKGKQRNMGHYFEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.65
4 0.7
5 0.74
6 0.79
7 0.85
8 0.87
9 0.89
10 0.9
11 0.92
12 0.91
13 0.86
14 0.82
15 0.79
16 0.76
17 0.72
18 0.66
19 0.59
20 0.5
21 0.44
22 0.39
23 0.31
24 0.23
25 0.17
26 0.12
27 0.12
28 0.14
29 0.16
30 0.15
31 0.15
32 0.14
33 0.14
34 0.14
35 0.11
36 0.08
37 0.07
38 0.07
39 0.07
40 0.06
41 0.07
42 0.06
43 0.06
44 0.06
45 0.05
46 0.1
47 0.13
48 0.2
49 0.23
50 0.24
51 0.27
52 0.28
53 0.3
54 0.34
55 0.36
56 0.39
57 0.41
58 0.43
59 0.42
60 0.41
61 0.42
62 0.36
63 0.36
64 0.34
65 0.35
66 0.41
67 0.45
68 0.5
69 0.55
70 0.61
71 0.67
72 0.65
73 0.62