FuNGI

A0A074Y2Y4

Protein Details

Accession

A0A074Y2Y4

Localization Confidence

High

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
23-56	QGTVRRRKPTGPFAPKPSRTQAKRPPAPPPQKLT	Hydrophilic
399-426	KAQERAERKKAKKLRKKLVKIEKNYEYD	Basic
595-615	SDLIRRFKERVPKENNKDFIK	Hydrophilic

NLS Segment(s)

Position	Sequence
27-50	RRRKPTGPFAPKPSRTQAKRPPAP
178-186	AKKRQPFKK
397-418	REKAQERAERKKAKKLRKKLVK

Subcellular Location(s)

nucl 19, mito 5, cyto 3

Family & Domain DBs

InterPro	View protein in InterPro IPR008851 TFIIF-alpha IPR011039 TFIIF_interaction
Gene Ontology	GO:0005634 C:nucleus GO:0003677 F:DNA binding GO:0032968 P:positive regulation of transcription elongation by RNA polymerase II GO:0006367 P:transcription initiation at RNA polymerase II promoter
Pfam	View protein in Pfam PF05793 TFIIF_alpha

Amino Acid Sequences

MSAPPPGVSPASRQPSTTPNNGQGTVRRRKPTGPFAPKPSRTQAKRPPAPPPQKLTGTTKPLAATTASAQSQPEPEDDPSLYEEFPLLTTKKAVLEGLRYHAMKFIADNEINPYDKTQFERPVKLHRRFPRDTPNAPTDANPEDDKEREKEVIRKAEKAAEREATQAQIAPTDKAAAAKKRQPFKKKTEDVYYLTDTPDTQKRARLRYEEGRPWHLEDFENKNIWIGTYEEPLSESNVMFLLSNGCFKMVPIEKWYRFNPTGRFKIMPLIEAEARMARNEKDPRWFLDNDKTAGQRRAELERQARLTRGRVGMRGENRIKNEDDDDDDREDLADDVDELDFEAEDEFQDDDEGKLFGDDEDEAKEAASKIKKERHGANIFAGTGVKDEKDWDKEEEREKAQERAERKKAKKLRKKLVKIEKNYEYDTDESDNPYSEDESEDSDTERLREEEERKKDEELKANGEKPASQMSTNANTPSGRAEKHAGSLQPKPSMSNLKRPGSPNLSETSGSESINRKRMKKQHGSGAGSPMGRLAGSGSDTETERRARPMTLNPRSTPGSPGAATPIGSRAGSPVPMPTADEVKAAIPPAGITISDLIRRFKERVPKENNKDFIKLVSSVARAMPGGQGLVGLR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.39
2	0.46
3	0.5
4	0.53
5	0.5
6	0.5
7	0.55
8	0.55
9	0.55
10	0.54
11	0.57
12	0.59
13	0.61
14	0.59
15	0.57
16	0.63
17	0.69
18	0.71
19	0.73
20	0.73
21	0.73
22	0.77
23	0.84
24	0.82
25	0.79
26	0.78
27	0.77
28	0.73
29	0.76
30	0.76
31	0.77
32	0.8
33	0.79
34	0.79
35	0.8
36	0.84
37	0.81
38	0.78
39	0.74
40	0.71
41	0.71
42	0.69
43	0.67
44	0.64
45	0.58
46	0.53
47	0.46
48	0.41
49	0.38
50	0.3
51	0.23
52	0.18
53	0.23
54	0.2
55	0.2
56	0.21
57	0.21
58	0.23
59	0.22
60	0.21
61	0.19
62	0.2
63	0.23
64	0.22
65	0.22
66	0.22
67	0.23
68	0.21
69	0.17
70	0.16
71	0.13
72	0.13
73	0.16
74	0.13
75	0.13
76	0.14
77	0.16
78	0.17
79	0.18
80	0.19
81	0.17
82	0.23
83	0.25
84	0.28
85	0.32
86	0.31
87	0.3
88	0.32
89	0.3
90	0.24
91	0.21
92	0.2
93	0.22
94	0.21
95	0.22
96	0.24
97	0.27
98	0.27
99	0.27
100	0.25
101	0.2
102	0.22
103	0.26
104	0.27
105	0.34
106	0.38
107	0.45
108	0.46
109	0.55
110	0.63
111	0.66
112	0.7
113	0.69
114	0.73
115	0.7
116	0.74
117	0.74
118	0.73
119	0.7
120	0.68
121	0.64
122	0.58
123	0.54
124	0.47
125	0.4
126	0.34
127	0.32
128	0.25
129	0.23
130	0.22
131	0.24
132	0.26
133	0.24
134	0.25
135	0.26
136	0.29
137	0.34
138	0.39
139	0.47
140	0.46
141	0.47
142	0.47
143	0.51
144	0.51
145	0.48
146	0.45
147	0.38
148	0.36
149	0.36
150	0.35
151	0.28
152	0.24
153	0.22
154	0.17
155	0.17
156	0.17
157	0.15
158	0.14
159	0.14
160	0.14
161	0.16
162	0.21
163	0.24
164	0.29
165	0.35
166	0.42
167	0.5
168	0.59
169	0.65
170	0.69
171	0.72
172	0.77
173	0.78
174	0.78
175	0.77
176	0.74
177	0.68
178	0.65
179	0.59
180	0.49
181	0.41
182	0.35
183	0.26
184	0.24
185	0.26
186	0.25
187	0.22
188	0.28
189	0.33
190	0.39
191	0.45
192	0.46
193	0.47
194	0.52
195	0.59
196	0.6
197	0.59
198	0.58
199	0.54
200	0.52
201	0.46
202	0.39
203	0.32
204	0.3
205	0.32
206	0.31
207	0.3
208	0.27
209	0.26
210	0.24
211	0.23
212	0.18
213	0.14
214	0.11
215	0.13
216	0.13
217	0.12
218	0.13
219	0.14
220	0.14
221	0.12
222	0.1
223	0.08
224	0.08
225	0.08
226	0.07
227	0.07
228	0.08
229	0.07
230	0.09
231	0.08
232	0.09
233	0.08
234	0.08
235	0.15
236	0.15
237	0.17
238	0.21
239	0.3
240	0.32
241	0.36
242	0.38
243	0.38
244	0.38
245	0.41
246	0.43
247	0.43
248	0.46
249	0.45
250	0.45
251	0.38
252	0.41
253	0.37
254	0.3
255	0.23
256	0.2
257	0.17
258	0.16
259	0.16
260	0.12
261	0.12
262	0.11
263	0.12
264	0.1
265	0.17
266	0.22
267	0.23
268	0.28
269	0.3
270	0.32
271	0.36
272	0.36
273	0.32
274	0.36
275	0.38
276	0.32
277	0.33
278	0.33
279	0.31
280	0.34
281	0.31
282	0.25
283	0.24
284	0.28
285	0.28
286	0.32
287	0.32
288	0.32
289	0.35
290	0.33
291	0.33
292	0.29
293	0.28
294	0.27
295	0.28
296	0.25
297	0.24
298	0.26
299	0.29
300	0.3
301	0.36
302	0.36
303	0.35
304	0.36
305	0.36
306	0.34
307	0.3
308	0.29
309	0.22
310	0.2
311	0.19
312	0.19
313	0.18
314	0.17
315	0.16
316	0.14
317	0.13
318	0.09
319	0.07
320	0.05
321	0.03
322	0.04
323	0.04
324	0.04
325	0.03
326	0.03
327	0.03
328	0.03
329	0.03
330	0.03
331	0.03
332	0.04
333	0.04
334	0.04
335	0.05
336	0.05
337	0.05
338	0.05
339	0.06
340	0.04
341	0.04
342	0.05
343	0.04
344	0.05
345	0.05
346	0.05
347	0.06
348	0.07
349	0.07
350	0.07
351	0.08
352	0.07
353	0.12
354	0.14
355	0.16
356	0.22
357	0.29
358	0.35
359	0.39
360	0.44
361	0.49
362	0.51
363	0.49
364	0.46
365	0.41
366	0.35
367	0.31
368	0.25
369	0.15
370	0.12
371	0.1
372	0.08
373	0.06
374	0.08
375	0.11
376	0.15
377	0.17
378	0.2
379	0.23
380	0.28
381	0.33
382	0.36
383	0.34
384	0.37
385	0.36
386	0.37
387	0.37
388	0.37
389	0.39
390	0.43
391	0.51
392	0.55
393	0.56
394	0.62
395	0.68
396	0.74
397	0.79
398	0.8
399	0.81
400	0.82
401	0.88
402	0.88
403	0.91
404	0.89
405	0.86
406	0.84
407	0.8
408	0.73
409	0.65
410	0.56
411	0.48
412	0.39
413	0.34
414	0.28
415	0.22
416	0.2
417	0.19
418	0.18
419	0.15
420	0.15
421	0.13
422	0.1
423	0.11
424	0.09
425	0.12
426	0.13
427	0.13
428	0.13
429	0.14
430	0.13
431	0.13
432	0.13
433	0.11
434	0.12
435	0.18
436	0.24
437	0.32
438	0.39
439	0.43
440	0.44
441	0.47
442	0.51
443	0.52
444	0.54
445	0.49
446	0.49
447	0.5
448	0.51
449	0.49
450	0.43
451	0.37
452	0.3
453	0.32
454	0.26
455	0.2
456	0.2
457	0.23
458	0.27
459	0.28
460	0.27
461	0.23
462	0.21
463	0.21
464	0.24
465	0.23
466	0.19
467	0.21
468	0.24
469	0.23
470	0.27
471	0.3
472	0.29
473	0.29
474	0.35
475	0.37
476	0.38
477	0.37
478	0.35
479	0.36
480	0.43
481	0.42
482	0.47
483	0.5
484	0.5
485	0.55
486	0.57
487	0.6
488	0.56
489	0.55
490	0.47
491	0.42
492	0.4
493	0.35
494	0.32
495	0.31
496	0.26
497	0.24
498	0.26
499	0.3
500	0.33
501	0.41
502	0.46
503	0.43
504	0.51
505	0.6
506	0.67
507	0.7
508	0.72
509	0.74
510	0.78
511	0.8
512	0.73
513	0.7
514	0.63
515	0.52
516	0.45
517	0.35
518	0.25
519	0.18
520	0.15
521	0.1
522	0.07
523	0.08
524	0.09
525	0.09
526	0.11
527	0.12
528	0.14
529	0.17
530	0.19
531	0.2
532	0.24
533	0.25
534	0.26
535	0.3
536	0.39
537	0.46
538	0.52
539	0.57
540	0.54
541	0.58
542	0.59
543	0.55
544	0.48
545	0.41
546	0.36
547	0.29
548	0.28
549	0.28
550	0.25
551	0.24
552	0.22
553	0.2
554	0.18
555	0.17
556	0.16
557	0.15
558	0.16
559	0.16
560	0.16
561	0.16
562	0.16
563	0.17
564	0.19
565	0.18
566	0.2
567	0.19
568	0.19
569	0.18
570	0.16
571	0.17
572	0.16
573	0.14
574	0.11
575	0.1
576	0.11
577	0.11
578	0.1
579	0.09
580	0.11
581	0.13
582	0.18
583	0.2
584	0.22
585	0.25
586	0.3
587	0.33
588	0.36
589	0.44
590	0.48
591	0.57
592	0.64
593	0.71
594	0.77
595	0.83
596	0.85
597	0.79
598	0.74
599	0.65
600	0.58
601	0.51
602	0.43
603	0.36
604	0.34
605	0.3
606	0.28
607	0.27
608	0.25
609	0.21
610	0.2
611	0.19
612	0.14
613	0.13
614	0.11

A0A074Y2Y4

3D AlphaFold-predicted Structure Viewer