Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074XAH2

Protein Details
Accession A0A074XAH2   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
85-106KSKVKVTKTKVGKKAKVYKRVSHydrophilic
NLS Segment(s)
PositionSequence
73-102KGKGKGKTKIIAKSKVKVTKTKVGKKAKVY
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
Amino Acid Sequences MSSIHYIIKFYFRKRPIFNVASIIEDYAIKHTRIATPNVVIFDKKIATTNITLASRSLEVPLINSFKEDIGDKGKGKGKTKIIAKSKVKVTKTKVGKKAKVYKRVSFLIEDDKDNGPIRRLTLIRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.61
3 0.61
4 0.59
5 0.56
6 0.53
7 0.47
8 0.42
9 0.37
10 0.3
11 0.21
12 0.18
13 0.16
14 0.15
15 0.17
16 0.14
17 0.15
18 0.16
19 0.22
20 0.25
21 0.28
22 0.26
23 0.26
24 0.27
25 0.28
26 0.28
27 0.22
28 0.19
29 0.17
30 0.15
31 0.13
32 0.13
33 0.12
34 0.13
35 0.14
36 0.15
37 0.17
38 0.17
39 0.16
40 0.14
41 0.15
42 0.13
43 0.13
44 0.11
45 0.08
46 0.07
47 0.08
48 0.11
49 0.1
50 0.1
51 0.1
52 0.09
53 0.08
54 0.09
55 0.09
56 0.08
57 0.11
58 0.15
59 0.15
60 0.2
61 0.25
62 0.29
63 0.32
64 0.37
65 0.38
66 0.42
67 0.47
68 0.51
69 0.53
70 0.59
71 0.6
72 0.59
73 0.63
74 0.64
75 0.62
76 0.61
77 0.6
78 0.59
79 0.65
80 0.68
81 0.69
82 0.72
83 0.75
84 0.78
85 0.82
86 0.82
87 0.82
88 0.8
89 0.77
90 0.73
91 0.7
92 0.63
93 0.55
94 0.49
95 0.48
96 0.43
97 0.38
98 0.35
99 0.32
100 0.33
101 0.34
102 0.32
103 0.26
104 0.26
105 0.26
106 0.3