Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074XT91

Protein Details
Accession A0A074XT91   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPKERATTRKTAKKDGGKKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
7-28TTRKTAKKDGGKKKKDPNAPKR
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKERATTRKTAKKDGGKKKKDPNAPKRGLSAYMFFANEQREKVREDNPGIKFGDVGKLLGEKWKSLNEKQKTPYEAKAAADKKRYEEEKAAYTAGGDAEEEEEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.83
4 0.83
5 0.86
6 0.87
7 0.87
8 0.87
9 0.87
10 0.87
11 0.87
12 0.84
13 0.77
14 0.71
15 0.64
16 0.57
17 0.48
18 0.39
19 0.31
20 0.27
21 0.25
22 0.2
23 0.2
24 0.2
25 0.2
26 0.19
27 0.18
28 0.17
29 0.19
30 0.22
31 0.24
32 0.26
33 0.29
34 0.35
35 0.35
36 0.37
37 0.34
38 0.31
39 0.27
40 0.22
41 0.21
42 0.14
43 0.12
44 0.09
45 0.09
46 0.1
47 0.13
48 0.13
49 0.1
50 0.12
51 0.18
52 0.22
53 0.28
54 0.38
55 0.39
56 0.46
57 0.5
58 0.55
59 0.54
60 0.53
61 0.51
62 0.47
63 0.44
64 0.39
65 0.43
66 0.42
67 0.43
68 0.46
69 0.44
70 0.42
71 0.48
72 0.49
73 0.45
74 0.46
75 0.45
76 0.43
77 0.44
78 0.4
79 0.31
80 0.29
81 0.24
82 0.18
83 0.14
84 0.09
85 0.07
86 0.08