Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074XDL1

Protein Details
Accession A0A074XDL1    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
73-100DAESHKAHEKSRKSRPKKKREKKTITSVBasic
NLS Segment(s)
PositionSequence
78-95KAHEKSRKSRPKKKREKK
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MQKSLSEDFGKAKSWQDLWNDTSATEQPQGYGREQENGKGHEESKDYSEQSEAKEESANVPTAKVYQDARIEDAESHKAHEKSRKSRPKKKREKKTITSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.32
4 0.35
5 0.34
6 0.36
7 0.33
8 0.28
9 0.28
10 0.25
11 0.22
12 0.19
13 0.16
14 0.14
15 0.18
16 0.21
17 0.19
18 0.23
19 0.21
20 0.25
21 0.25
22 0.3
23 0.29
24 0.29
25 0.3
26 0.26
27 0.26
28 0.23
29 0.24
30 0.2
31 0.19
32 0.2
33 0.18
34 0.16
35 0.18
36 0.16
37 0.15
38 0.18
39 0.15
40 0.13
41 0.13
42 0.13
43 0.13
44 0.14
45 0.15
46 0.11
47 0.11
48 0.11
49 0.11
50 0.12
51 0.12
52 0.11
53 0.14
54 0.18
55 0.19
56 0.21
57 0.2
58 0.21
59 0.19
60 0.21
61 0.22
62 0.18
63 0.2
64 0.25
65 0.26
66 0.3
67 0.38
68 0.44
69 0.49
70 0.6
71 0.68
72 0.73
73 0.82
74 0.88
75 0.91
76 0.93
77 0.94
78 0.95
79 0.95
80 0.95