Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074W2X4

Protein Details
Accession A0A074W2X4    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
17-45WKIPWRLSAPQKLRQRRRLRRVDNIVSVLHydrophilic
149-184RDKYTMFDRKEKKYRKGIHKLPKWTRVSQRVNPPGFHydrophilic
NLS Segment(s)
PositionSequence
158-171KEKKYRKGIHKLPK
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFKPTSALSGGLLWKIPWRLSAPQKLRQRRRLRRVDNIVSVLDSALQRQVQSQPATTATKGIGATQATTGELSQTAQGQRLMNAETNAPLNELRHGRGPRQGDILSGSLPTGTVTMTGDQARKMGTIKLLERWKADMPTEAEMLPRDKYTMFDRKEKKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.14
4 0.18
5 0.19
6 0.19
7 0.19
8 0.21
9 0.29
10 0.37
11 0.47
12 0.5
13 0.56
14 0.66
15 0.74
16 0.8
17 0.82
18 0.85
19 0.85
20 0.89
21 0.91
22 0.89
23 0.89
24 0.89
25 0.86
26 0.8
27 0.72
28 0.62
29 0.51
30 0.43
31 0.32
32 0.24
33 0.16
34 0.11
35 0.11
36 0.11
37 0.1
38 0.12
39 0.16
40 0.19
41 0.2
42 0.2
43 0.19
44 0.22
45 0.25
46 0.23
47 0.21
48 0.15
49 0.17
50 0.16
51 0.14
52 0.14
53 0.12
54 0.12
55 0.11
56 0.11
57 0.09
58 0.09
59 0.08
60 0.06
61 0.06
62 0.06
63 0.06
64 0.08
65 0.08
66 0.09
67 0.11
68 0.11
69 0.12
70 0.13
71 0.13
72 0.12
73 0.12
74 0.11
75 0.1
76 0.1
77 0.09
78 0.09
79 0.08
80 0.07
81 0.1
82 0.11
83 0.11
84 0.17
85 0.18
86 0.19
87 0.24
88 0.27
89 0.25
90 0.28
91 0.27
92 0.21
93 0.22
94 0.21
95 0.16
96 0.13
97 0.11
98 0.07
99 0.07
100 0.07
101 0.05
102 0.04
103 0.04
104 0.05
105 0.05
106 0.07
107 0.1
108 0.1
109 0.1
110 0.11
111 0.11
112 0.11
113 0.12
114 0.11
115 0.13
116 0.16
117 0.18
118 0.25
119 0.3
120 0.32
121 0.32
122 0.34
123 0.34
124 0.32
125 0.31
126 0.29
127 0.26
128 0.26
129 0.26
130 0.23
131 0.2
132 0.2
133 0.21
134 0.17
135 0.15
136 0.14
137 0.13
138 0.15
139 0.22
140 0.29
141 0.32
142 0.4
143 0.47
144 0.56
145 0.66
146 0.73
147 0.75
148 0.76
149 0.82
150 0.83
151 0.87
152 0.87
153 0.88
154 0.88
155 0.9
156 0.89
157 0.89
158 0.84
159 0.82
160 0.81
161 0.81
162 0.81
163 0.79
164 0.8