Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EJU0

Protein Details
Accession A7EJU0    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-32NHNHITRKECVRERGRKREKNGIQYEBasic
NLS Segment(s)
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR008160  Collagen  
KEGG ssl:SS1G_05585  -  
Pfam View protein in Pfam  
PF01391  Collagen  
Amino Acid Sequences MSLHKYNHNHITRKECVRERGRKREKNGIQYEEIVRAVILILKGEEGEEGEEGEEGEEGEEGEEGEEGEEGEEGEEGEEREEREEWEEWEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.65
3 0.67
4 0.7
5 0.75
6 0.77
7 0.8
8 0.83
9 0.83
10 0.83
11 0.84
12 0.82
13 0.81
14 0.79
15 0.73
16 0.64
17 0.59
18 0.54
19 0.45
20 0.37
21 0.26
22 0.18
23 0.13
24 0.1
25 0.08
26 0.07
27 0.05
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.03
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.04
63 0.05
64 0.06
65 0.08
66 0.08
67 0.11
68 0.12
69 0.13
70 0.16
71 0.18