Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074VIY1

Protein Details
Accession A0A074VIY1    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-27GISKQRASKACNRCRAKKSRCSGGYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MGGISKQRASKACNRCRAKKSRCSGGYPCSKCKSSDAPCIFGYPNESKRKVFSEHYVRTLETQQFKLVAGLQTMYFLLLATNSWPGKKLPERKGNPLVHDLLDRLGLLETGKNGTDHEGSGRRRGRIRHISECH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.75
3 0.81
4 0.85
5 0.85
6 0.84
7 0.83
8 0.83
9 0.79
10 0.77
11 0.74
12 0.72
13 0.73
14 0.68
15 0.68
16 0.62
17 0.59
18 0.53
19 0.52
20 0.52
21 0.48
22 0.53
23 0.49
24 0.47
25 0.46
26 0.47
27 0.42
28 0.33
29 0.32
30 0.27
31 0.32
32 0.35
33 0.37
34 0.35
35 0.38
36 0.41
37 0.39
38 0.36
39 0.37
40 0.4
41 0.41
42 0.44
43 0.42
44 0.39
45 0.37
46 0.37
47 0.34
48 0.26
49 0.24
50 0.21
51 0.2
52 0.2
53 0.18
54 0.15
55 0.11
56 0.08
57 0.08
58 0.07
59 0.07
60 0.07
61 0.07
62 0.05
63 0.04
64 0.04
65 0.03
66 0.04
67 0.04
68 0.08
69 0.09
70 0.09
71 0.1
72 0.11
73 0.18
74 0.26
75 0.35
76 0.4
77 0.51
78 0.55
79 0.63
80 0.72
81 0.69
82 0.65
83 0.6
84 0.52
85 0.43
86 0.39
87 0.31
88 0.22
89 0.18
90 0.15
91 0.11
92 0.09
93 0.08
94 0.07
95 0.08
96 0.08
97 0.09
98 0.1
99 0.1
100 0.1
101 0.13
102 0.14
103 0.14
104 0.19
105 0.25
106 0.27
107 0.36
108 0.41
109 0.43
110 0.48
111 0.52
112 0.57
113 0.6
114 0.66