Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074VFR8

Protein Details
Accession A0A074VFR8    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-41QTLEHKHKQLQEKKGRKKVPPKRGRHLVEBasic
NLS Segment(s)
PositionSequence
22-37LQEKKGRKKVPPKRGR
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
Amino Acid Sequences KTVELAQLQLKYQTLEHKHKQLQEKKGRKKVPPKRGRHLVEADDIVRKQQEWNKENTTPPPPRKTLRSAMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.37
3 0.42
4 0.49
5 0.53
6 0.58
7 0.67
8 0.67
9 0.7
10 0.72
11 0.76
12 0.78
13 0.83
14 0.83
15 0.81
16 0.84
17 0.84
18 0.84
19 0.84
20 0.81
21 0.81
22 0.84
23 0.79
24 0.74
25 0.68
26 0.59
27 0.51
28 0.44
29 0.36
30 0.29
31 0.25
32 0.2
33 0.16
34 0.14
35 0.16
36 0.19
37 0.28
38 0.29
39 0.36
40 0.41
41 0.45
42 0.48
43 0.5
44 0.55
45 0.55
46 0.6
47 0.61
48 0.61
49 0.63
50 0.66
51 0.67