Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074VGS8

Protein Details
Accession A0A074VGS8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-44AAHRSNVYQPSKRQRKRDRAIVREQRRLNRRHydrophilic
NLS Segment(s)
PositionSequence
25-45KRQRKRDRAIVREQRRLNRRP
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, mito 9, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MNCPYCIPGQQRCAAHRSNVYQPSKRQRKRDRAIVREQRRLNRRPPVGSPLGGPQQQQHAANQQPPFGQQPPFTAGQVPFGAGQVPFGVGQTQQQVPFYGQQFPFYSQQFPFYGQQFPFYGQQFPFYGQQFPFSGQQFPLGTGQGTQQFGGQQLPTTAVEAQQQLPGQQSPGQQLPGQQLLGQQLPGQQLPGQQLPGQQLPGQQLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.49
3 0.49
4 0.48
5 0.5
6 0.55
7 0.59
8 0.6
9 0.65
10 0.71
11 0.75
12 0.78
13 0.79
14 0.81
15 0.85
16 0.87
17 0.89
18 0.89
19 0.86
20 0.89
21 0.89
22 0.87
23 0.86
24 0.83
25 0.82
26 0.8
27 0.78
28 0.75
29 0.74
30 0.72
31 0.67
32 0.65
33 0.63
34 0.58
35 0.52
36 0.45
37 0.4
38 0.4
39 0.36
40 0.32
41 0.26
42 0.27
43 0.3
44 0.29
45 0.26
46 0.27
47 0.29
48 0.34
49 0.33
50 0.29
51 0.26
52 0.27
53 0.29
54 0.25
55 0.24
56 0.2
57 0.22
58 0.23
59 0.24
60 0.23
61 0.22
62 0.19
63 0.19
64 0.18
65 0.16
66 0.13
67 0.11
68 0.12
69 0.09
70 0.09
71 0.06
72 0.06
73 0.05
74 0.05
75 0.06
76 0.05
77 0.06
78 0.09
79 0.1
80 0.1
81 0.1
82 0.11
83 0.12
84 0.15
85 0.15
86 0.18
87 0.17
88 0.19
89 0.2
90 0.22
91 0.24
92 0.21
93 0.23
94 0.17
95 0.2
96 0.18
97 0.2
98 0.2
99 0.18
100 0.22
101 0.19
102 0.21
103 0.19
104 0.2
105 0.21
106 0.2
107 0.21
108 0.17
109 0.19
110 0.17
111 0.19
112 0.2
113 0.18
114 0.2
115 0.17
116 0.19
117 0.18
118 0.19
119 0.21
120 0.19
121 0.2
122 0.17
123 0.2
124 0.18
125 0.19
126 0.18
127 0.14
128 0.13
129 0.12
130 0.14
131 0.14
132 0.15
133 0.13
134 0.13
135 0.13
136 0.14
137 0.15
138 0.13
139 0.1
140 0.09
141 0.12
142 0.11
143 0.12
144 0.12
145 0.11
146 0.13
147 0.15
148 0.15
149 0.16
150 0.16
151 0.15
152 0.18
153 0.17
154 0.16
155 0.18
156 0.19
157 0.21
158 0.23
159 0.25
160 0.23
161 0.26
162 0.29
163 0.28
164 0.26
165 0.22
166 0.22
167 0.23
168 0.24
169 0.21
170 0.17
171 0.18
172 0.2
173 0.19
174 0.19
175 0.17
176 0.19
177 0.23
178 0.25
179 0.24
180 0.22
181 0.25
182 0.29
183 0.3
184 0.29
185 0.25
186 0.26