Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074VRT5

Protein Details
Accession A0A074VRT5    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
94-132DPSHRVRKRRSGFLARIRSRNGRNLIKRRLLKKRTTLSHHydrophilic
NLS Segment(s)
PositionSequence
97-127HRVRKRRSGFLARIRSRNGRNLIKRRLLKKR
Subcellular Location(s) mito 15, nucl 11.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLLLRCIRQVAQLRSSLSLASTTSLLQSSLRPLAASQPAQSRTFSLLSARRPTLPSTPTSTLSLNTTLELPTLPAASTTLTLLQARGPKRDTYDPSHRVRKRRSGFLARIRSRNGRNLIKRRLLKKRTTLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.34
4 0.25
5 0.2
6 0.16
7 0.13
8 0.11
9 0.09
10 0.1
11 0.1
12 0.1
13 0.09
14 0.1
15 0.13
16 0.14
17 0.14
18 0.13
19 0.13
20 0.18
21 0.22
22 0.22
23 0.21
24 0.25
25 0.29
26 0.3
27 0.3
28 0.26
29 0.24
30 0.23
31 0.21
32 0.2
33 0.21
34 0.25
35 0.29
36 0.29
37 0.28
38 0.29
39 0.31
40 0.31
41 0.28
42 0.26
43 0.27
44 0.29
45 0.28
46 0.29
47 0.27
48 0.23
49 0.22
50 0.21
51 0.15
52 0.12
53 0.11
54 0.09
55 0.08
56 0.08
57 0.06
58 0.05
59 0.05
60 0.05
61 0.04
62 0.05
63 0.05
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.07
70 0.1
71 0.15
72 0.16
73 0.2
74 0.21
75 0.22
76 0.27
77 0.34
78 0.36
79 0.39
80 0.47
81 0.51
82 0.56
83 0.65
84 0.66
85 0.68
86 0.71
87 0.74
88 0.71
89 0.73
90 0.75
91 0.74
92 0.78
93 0.79
94 0.82
95 0.77
96 0.76
97 0.72
98 0.71
99 0.66
100 0.66
101 0.64
102 0.63
103 0.68
104 0.72
105 0.76
106 0.78
107 0.81
108 0.82
109 0.85
110 0.83
111 0.82
112 0.82