Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074VL79

Protein Details
Accession A0A074VL79    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
21-43ILKAVPKKKTSHMKKRHRQMAGKBasic
NLS Segment(s)
PositionSequence
26-41PKKKTSHMKKRHRQMA
Subcellular Location(s) cyto 11.5, mito 11, cyto_nucl 8.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences PLLPSIVIPIPGLVSDIWESILKAVPKKKTSHMKKRHRQMAGKGLKDVTSLNKCSGCGRVKRAHYLCPHCVMSMSMLSGLLPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.1
5 0.1
6 0.1
7 0.1
8 0.14
9 0.14
10 0.18
11 0.23
12 0.29
13 0.33
14 0.36
15 0.44
16 0.51
17 0.6
18 0.66
19 0.71
20 0.76
21 0.81
22 0.88
23 0.88
24 0.85
25 0.8
26 0.75
27 0.75
28 0.72
29 0.63
30 0.54
31 0.46
32 0.39
33 0.33
34 0.27
35 0.23
36 0.2
37 0.21
38 0.22
39 0.22
40 0.23
41 0.23
42 0.29
43 0.29
44 0.3
45 0.35
46 0.41
47 0.44
48 0.53
49 0.54
50 0.55
51 0.58
52 0.6
53 0.58
54 0.56
55 0.53
56 0.43
57 0.42
58 0.35
59 0.28
60 0.22
61 0.19
62 0.13
63 0.12