Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EFS2

Protein Details
Accession A7EFS2   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
32-56QMMADTKKRRDAKRNKIENERAQRIHydrophilic
NLS Segment(s)
PositionSequence
38-63KKRRDAKRNKIENERAQRIKDVKKKL
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
KEGG ssl:SS1G_04163  -  
Amino Acid Sequences MSPRFNMDDDAASLVSSQDSITGMEFVQRANQMMADTKKRRDAKRNKIENERAQRIKDVKKKLGVLYENRKTQRSKIQKAQWKQLSTLNTRRQDLERQILDSMAVIEGSTLIMVRELNAVLLGRLDAMRSLADAQSAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.09
4 0.07
5 0.05
6 0.06
7 0.07
8 0.07
9 0.08
10 0.08
11 0.1
12 0.11
13 0.1
14 0.13
15 0.13
16 0.14
17 0.13
18 0.14
19 0.12
20 0.18
21 0.22
22 0.28
23 0.32
24 0.34
25 0.43
26 0.5
27 0.56
28 0.61
29 0.67
30 0.69
31 0.76
32 0.83
33 0.8
34 0.83
35 0.85
36 0.83
37 0.82
38 0.79
39 0.71
40 0.62
41 0.61
42 0.57
43 0.57
44 0.56
45 0.54
46 0.5
47 0.51
48 0.53
49 0.49
50 0.49
51 0.45
52 0.44
53 0.46
54 0.47
55 0.48
56 0.47
57 0.48
58 0.43
59 0.43
60 0.46
61 0.47
62 0.48
63 0.51
64 0.58
65 0.64
66 0.68
67 0.74
68 0.71
69 0.62
70 0.57
71 0.52
72 0.49
73 0.47
74 0.51
75 0.5
76 0.47
77 0.47
78 0.48
79 0.46
80 0.47
81 0.47
82 0.46
83 0.38
84 0.36
85 0.35
86 0.32
87 0.29
88 0.22
89 0.17
90 0.09
91 0.07
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.03
98 0.03
99 0.04
100 0.04
101 0.05
102 0.06
103 0.06
104 0.07
105 0.08
106 0.08
107 0.07
108 0.08
109 0.07
110 0.07
111 0.07
112 0.07
113 0.06
114 0.07
115 0.07
116 0.08
117 0.11
118 0.1