Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074WV06

Protein Details
Accession A0A074WV06   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
350-384IPALQTPKKNKPPAKTPLHRKEKHAPRPVQKDLDMHydrophilic
423-444SGDRRRAYRVWERKVRARCAEIHydrophilic
NLS Segment(s)
PositionSequence
357-376KKNKPPAKTPLHRKEKHAPR
Subcellular Location(s) nucl 12.5cyto_nucl 12.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008721  ORC6  
Gene Ontology GO:0005664  C:nuclear origin of replication recognition complex  
GO:0003677  F:DNA binding  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF05460  ORC6  
Amino Acid Sequences MPTTIEQALITLVPTLNSLPQELIDLSTSLLAQSRNKASSLKPEEEIGRTYTCAHIAVDRLKHRLDIDKVVARPPVAPRIYKKLYGYLDAALKEPATPRTNRLKDVSTTGTPGSGRGRRSVLGTPVGTPSKTPAKSVKSAGVTPSKTPASVAKSVDSVTGSGRRTRSAKKATEEEVVIQDSEEERQRETAKDQEEDNLPEHVRPMAEAVCDALNVPQATPHVCAALSAILPLRGWKDTQPEPTPHSSAKKRKRTSTDGEEVAAIEDSSTITPSSLPALIAALSLVTTFTLRNTVIDGTTYATARSSAITALSPSSPTPKDVDAFLHASKTEGWLELPWFTTVKASTLPSIPALQTPKKNKPPAKTPLHRKEKHAPRPVQKDLDMDTVMEDVDKEAEEEDRDRPGAGLRSGLGTMFQDSVDWLSGDRRRAYRVWERKVRARCAEIESKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.13
4 0.14
5 0.14
6 0.13
7 0.13
8 0.15
9 0.15
10 0.15
11 0.13
12 0.13
13 0.12
14 0.12
15 0.12
16 0.1
17 0.12
18 0.13
19 0.15
20 0.22
21 0.28
22 0.29
23 0.3
24 0.33
25 0.34
26 0.42
27 0.46
28 0.44
29 0.39
30 0.41
31 0.44
32 0.43
33 0.43
34 0.35
35 0.29
36 0.25
37 0.26
38 0.23
39 0.21
40 0.19
41 0.17
42 0.16
43 0.19
44 0.25
45 0.31
46 0.33
47 0.36
48 0.36
49 0.37
50 0.37
51 0.41
52 0.39
53 0.38
54 0.4
55 0.43
56 0.44
57 0.45
58 0.44
59 0.37
60 0.36
61 0.33
62 0.35
63 0.32
64 0.36
65 0.37
66 0.45
67 0.49
68 0.5
69 0.48
70 0.47
71 0.46
72 0.45
73 0.42
74 0.36
75 0.35
76 0.31
77 0.3
78 0.22
79 0.2
80 0.17
81 0.18
82 0.21
83 0.21
84 0.22
85 0.28
86 0.38
87 0.42
88 0.45
89 0.47
90 0.45
91 0.42
92 0.47
93 0.46
94 0.36
95 0.35
96 0.31
97 0.29
98 0.25
99 0.25
100 0.26
101 0.25
102 0.25
103 0.26
104 0.28
105 0.27
106 0.3
107 0.32
108 0.29
109 0.3
110 0.29
111 0.27
112 0.29
113 0.3
114 0.26
115 0.22
116 0.22
117 0.26
118 0.26
119 0.28
120 0.31
121 0.35
122 0.39
123 0.42
124 0.43
125 0.38
126 0.39
127 0.4
128 0.4
129 0.36
130 0.33
131 0.35
132 0.29
133 0.26
134 0.26
135 0.26
136 0.24
137 0.27
138 0.27
139 0.23
140 0.24
141 0.24
142 0.24
143 0.2
144 0.15
145 0.12
146 0.16
147 0.16
148 0.2
149 0.2
150 0.23
151 0.27
152 0.32
153 0.39
154 0.42
155 0.47
156 0.48
157 0.52
158 0.51
159 0.5
160 0.45
161 0.37
162 0.31
163 0.26
164 0.2
165 0.15
166 0.12
167 0.09
168 0.11
169 0.12
170 0.11
171 0.11
172 0.13
173 0.15
174 0.16
175 0.18
176 0.22
177 0.21
178 0.22
179 0.22
180 0.23
181 0.24
182 0.25
183 0.24
184 0.2
185 0.18
186 0.16
187 0.16
188 0.13
189 0.11
190 0.09
191 0.09
192 0.08
193 0.07
194 0.07
195 0.08
196 0.07
197 0.07
198 0.07
199 0.06
200 0.07
201 0.07
202 0.07
203 0.07
204 0.08
205 0.09
206 0.1
207 0.1
208 0.08
209 0.08
210 0.08
211 0.07
212 0.08
213 0.06
214 0.06
215 0.06
216 0.05
217 0.06
218 0.06
219 0.07
220 0.07
221 0.08
222 0.09
223 0.15
224 0.18
225 0.24
226 0.27
227 0.29
228 0.32
229 0.35
230 0.36
231 0.33
232 0.36
233 0.39
234 0.46
235 0.53
236 0.6
237 0.62
238 0.68
239 0.73
240 0.73
241 0.73
242 0.71
243 0.67
244 0.58
245 0.53
246 0.45
247 0.37
248 0.3
249 0.22
250 0.12
251 0.06
252 0.05
253 0.04
254 0.04
255 0.05
256 0.04
257 0.04
258 0.05
259 0.05
260 0.07
261 0.07
262 0.06
263 0.06
264 0.06
265 0.06
266 0.06
267 0.06
268 0.04
269 0.03
270 0.03
271 0.03
272 0.03
273 0.03
274 0.04
275 0.04
276 0.07
277 0.07
278 0.07
279 0.09
280 0.09
281 0.09
282 0.1
283 0.1
284 0.09
285 0.11
286 0.11
287 0.09
288 0.08
289 0.09
290 0.09
291 0.09
292 0.07
293 0.06
294 0.07
295 0.07
296 0.08
297 0.09
298 0.09
299 0.09
300 0.09
301 0.15
302 0.14
303 0.16
304 0.17
305 0.18
306 0.18
307 0.19
308 0.2
309 0.19
310 0.22
311 0.21
312 0.2
313 0.18
314 0.18
315 0.17
316 0.17
317 0.14
318 0.11
319 0.11
320 0.11
321 0.13
322 0.13
323 0.14
324 0.13
325 0.12
326 0.12
327 0.13
328 0.12
329 0.13
330 0.14
331 0.14
332 0.15
333 0.16
334 0.17
335 0.16
336 0.18
337 0.17
338 0.19
339 0.24
340 0.28
341 0.35
342 0.43
343 0.51
344 0.59
345 0.69
346 0.71
347 0.73
348 0.77
349 0.78
350 0.81
351 0.81
352 0.82
353 0.83
354 0.88
355 0.84
356 0.82
357 0.82
358 0.82
359 0.83
360 0.82
361 0.81
362 0.8
363 0.85
364 0.85
365 0.8
366 0.72
367 0.65
368 0.59
369 0.55
370 0.45
371 0.35
372 0.28
373 0.22
374 0.19
375 0.15
376 0.11
377 0.07
378 0.07
379 0.07
380 0.06
381 0.07
382 0.09
383 0.11
384 0.13
385 0.14
386 0.17
387 0.18
388 0.18
389 0.17
390 0.21
391 0.24
392 0.22
393 0.22
394 0.19
395 0.21
396 0.21
397 0.2
398 0.17
399 0.13
400 0.14
401 0.13
402 0.12
403 0.1
404 0.1
405 0.12
406 0.12
407 0.11
408 0.1
409 0.16
410 0.21
411 0.27
412 0.32
413 0.33
414 0.37
415 0.39
416 0.47
417 0.51
418 0.58
419 0.63
420 0.67
421 0.72
422 0.76
423 0.83
424 0.84
425 0.81
426 0.75
427 0.7
428 0.68