Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074WMG5

Protein Details
Accession A0A074WMG5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28KTTKAACSACRKRKSKCDGKRPTCSSCIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences KTTKAACSACRKRKSKCDGKRPTCSSCITKNKPCEYLAEEGVSSQAASRKRLEGYATVLRLLQDAHPEDCDRIIRDLRRSKSLAGGVKTVLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.84
4 0.85
5 0.87
6 0.89
7 0.9
8 0.86
9 0.81
10 0.74
11 0.69
12 0.63
13 0.61
14 0.63
15 0.6
16 0.61
17 0.65
18 0.64
19 0.62
20 0.57
21 0.51
22 0.43
23 0.39
24 0.33
25 0.25
26 0.2
27 0.17
28 0.17
29 0.13
30 0.09
31 0.06
32 0.09
33 0.09
34 0.12
35 0.13
36 0.15
37 0.16
38 0.17
39 0.18
40 0.16
41 0.2
42 0.23
43 0.22
44 0.21
45 0.2
46 0.19
47 0.18
48 0.17
49 0.12
50 0.12
51 0.14
52 0.15
53 0.16
54 0.17
55 0.18
56 0.19
57 0.2
58 0.17
59 0.19
60 0.25
61 0.27
62 0.36
63 0.45
64 0.47
65 0.52
66 0.52
67 0.49
68 0.5
69 0.53
70 0.51
71 0.44
72 0.42