Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074VL04

Protein Details
Accession A0A074VL04    Localization Confidence High Confidence Score 20.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-36QSAPATHKQPSRKGKKAWRKNVDITELQHydrophilic
277-314DSGVVTKKRPERKTPSQRNKIKRRKELEQKAKWDKQMKBasic
411-438LNGKMESRRTMQHKKPKREVTEKWSYKDHydrophilic
NLS Segment(s)
PositionSequence
18-27PSRKGKKAWR
283-316KKRPERKTPSQRNKIKRRKELEQKAKWDKQMKKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0000027  P:ribosomal large subunit assembly  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences MAPVAEKTQSAPATHKQPSRKGKKAWRKNVDITELQAGVEDVREQIIQGGVLTERPAEELFVTDVKGADSIKDDFNKRHKPLKADEIIAQRSKVPAVDTRKRKSDGIATGSSKRNKNGTYVSHKDLQHLRSVANSAGAQSDIIKASESADHDPWSMEPLPQDPRFSFIPEKKAKVAPKTLKHAPISLAANGKPFAAVPKPSAGKSYNPTFEDWEAHVTKVGEREVAAERKRLQEAQEEHDRLEKALAEAARPEPATDDEYQSAYESEWEGIQSEAEDSGVVTKKRPERKTPSQRNKIKRRKELEQKAKWDKQMKKKEEQLARVKEIALQLAEKERLLAEQKALQPAETGAEAEAEINDEDESEVLRRRTLGKHAVPDAPLEVVLADELQDSLRALRPEGNLLKDRYRNLLLNGKMESRRTMQHKKPKREVTEKWSYKDWKLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.53
3 0.54
4 0.62
5 0.71
6 0.76
7 0.78
8 0.8
9 0.83
10 0.88
11 0.91
12 0.92
13 0.91
14 0.89
15 0.89
16 0.87
17 0.83
18 0.75
19 0.67
20 0.61
21 0.51
22 0.41
23 0.32
24 0.24
25 0.17
26 0.15
27 0.12
28 0.07
29 0.08
30 0.08
31 0.08
32 0.09
33 0.09
34 0.09
35 0.08
36 0.09
37 0.08
38 0.09
39 0.1
40 0.09
41 0.08
42 0.1
43 0.1
44 0.1
45 0.1
46 0.1
47 0.12
48 0.12
49 0.13
50 0.12
51 0.12
52 0.11
53 0.12
54 0.11
55 0.09
56 0.12
57 0.14
58 0.18
59 0.23
60 0.26
61 0.32
62 0.42
63 0.51
64 0.53
65 0.6
66 0.6
67 0.61
68 0.65
69 0.68
70 0.64
71 0.57
72 0.58
73 0.57
74 0.58
75 0.53
76 0.46
77 0.37
78 0.33
79 0.3
80 0.25
81 0.2
82 0.21
83 0.29
84 0.38
85 0.46
86 0.52
87 0.58
88 0.6
89 0.59
90 0.56
91 0.55
92 0.52
93 0.49
94 0.49
95 0.46
96 0.49
97 0.55
98 0.57
99 0.52
100 0.48
101 0.47
102 0.42
103 0.44
104 0.44
105 0.45
106 0.48
107 0.51
108 0.51
109 0.52
110 0.52
111 0.52
112 0.52
113 0.45
114 0.42
115 0.37
116 0.33
117 0.28
118 0.29
119 0.24
120 0.2
121 0.18
122 0.12
123 0.12
124 0.12
125 0.1
126 0.09
127 0.1
128 0.08
129 0.08
130 0.08
131 0.08
132 0.09
133 0.11
134 0.13
135 0.14
136 0.15
137 0.16
138 0.16
139 0.16
140 0.15
141 0.17
142 0.15
143 0.13
144 0.12
145 0.15
146 0.21
147 0.22
148 0.25
149 0.2
150 0.23
151 0.23
152 0.26
153 0.3
154 0.28
155 0.36
156 0.38
157 0.41
158 0.41
159 0.46
160 0.47
161 0.46
162 0.51
163 0.5
164 0.51
165 0.55
166 0.58
167 0.58
168 0.55
169 0.51
170 0.42
171 0.39
172 0.34
173 0.3
174 0.27
175 0.21
176 0.21
177 0.19
178 0.18
179 0.13
180 0.11
181 0.11
182 0.11
183 0.11
184 0.11
185 0.16
186 0.18
187 0.18
188 0.21
189 0.21
190 0.22
191 0.25
192 0.29
193 0.28
194 0.28
195 0.29
196 0.28
197 0.27
198 0.26
199 0.22
200 0.22
201 0.18
202 0.17
203 0.17
204 0.15
205 0.15
206 0.15
207 0.14
208 0.1
209 0.09
210 0.12
211 0.14
212 0.19
213 0.19
214 0.21
215 0.22
216 0.25
217 0.26
218 0.25
219 0.23
220 0.25
221 0.27
222 0.29
223 0.36
224 0.34
225 0.33
226 0.35
227 0.34
228 0.26
229 0.24
230 0.19
231 0.11
232 0.13
233 0.12
234 0.09
235 0.1
236 0.11
237 0.12
238 0.11
239 0.11
240 0.09
241 0.11
242 0.13
243 0.13
244 0.15
245 0.14
246 0.14
247 0.15
248 0.14
249 0.13
250 0.1
251 0.09
252 0.08
253 0.07
254 0.07
255 0.06
256 0.07
257 0.06
258 0.06
259 0.06
260 0.05
261 0.05
262 0.05
263 0.04
264 0.04
265 0.07
266 0.11
267 0.11
268 0.12
269 0.18
270 0.26
271 0.36
272 0.41
273 0.47
274 0.54
275 0.65
276 0.75
277 0.81
278 0.84
279 0.86
280 0.9
281 0.91
282 0.93
283 0.92
284 0.91
285 0.89
286 0.86
287 0.85
288 0.87
289 0.87
290 0.87
291 0.85
292 0.85
293 0.85
294 0.83
295 0.8
296 0.78
297 0.76
298 0.76
299 0.78
300 0.75
301 0.73
302 0.76
303 0.78
304 0.76
305 0.77
306 0.76
307 0.72
308 0.69
309 0.62
310 0.53
311 0.47
312 0.4
313 0.33
314 0.23
315 0.17
316 0.14
317 0.17
318 0.18
319 0.15
320 0.14
321 0.13
322 0.14
323 0.17
324 0.18
325 0.15
326 0.21
327 0.24
328 0.29
329 0.29
330 0.26
331 0.23
332 0.22
333 0.22
334 0.16
335 0.14
336 0.08
337 0.08
338 0.08
339 0.08
340 0.07
341 0.07
342 0.06
343 0.07
344 0.06
345 0.06
346 0.06
347 0.06
348 0.07
349 0.08
350 0.12
351 0.12
352 0.13
353 0.15
354 0.19
355 0.23
356 0.3
357 0.38
358 0.4
359 0.46
360 0.5
361 0.52
362 0.49
363 0.46
364 0.39
365 0.3
366 0.24
367 0.17
368 0.12
369 0.08
370 0.08
371 0.06
372 0.05
373 0.04
374 0.05
375 0.05
376 0.06
377 0.06
378 0.08
379 0.13
380 0.13
381 0.14
382 0.2
383 0.21
384 0.29
385 0.34
386 0.38
387 0.39
388 0.43
389 0.5
390 0.49
391 0.5
392 0.48
393 0.49
394 0.46
395 0.45
396 0.5
397 0.45
398 0.45
399 0.45
400 0.45
401 0.44
402 0.43
403 0.42
404 0.37
405 0.42
406 0.47
407 0.54
408 0.58
409 0.66
410 0.74
411 0.8
412 0.87
413 0.89
414 0.9
415 0.9
416 0.89
417 0.87
418 0.88
419 0.84
420 0.78
421 0.77
422 0.72