Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074VZ57

Protein Details
Accession A0A074VZ57    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
101-126DASRVTEKQKKKQIHFPQRNYAVKVRHydrophilic
NLS Segment(s)
PositionSequence
91-99RAIRRRLSK
108-111KQKK
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSAKVKASQLWSKNKDELKTQLEELKAELVQLRTQKIAGGAQSKLTRIHDVRKSIARVLTVININQRSQLRIFYKNKKYLPLDLRAKQTRAIRRRLSKEDASRVTEKQKKKQIHFPQRNYAVKVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.64
3 0.59
4 0.56
5 0.55
6 0.5
7 0.47
8 0.44
9 0.42
10 0.37
11 0.35
12 0.3
13 0.25
14 0.2
15 0.17
16 0.17
17 0.14
18 0.16
19 0.18
20 0.19
21 0.17
22 0.17
23 0.17
24 0.16
25 0.16
26 0.16
27 0.17
28 0.15
29 0.19
30 0.2
31 0.21
32 0.21
33 0.21
34 0.24
35 0.22
36 0.3
37 0.31
38 0.33
39 0.35
40 0.38
41 0.38
42 0.35
43 0.35
44 0.27
45 0.23
46 0.2
47 0.19
48 0.15
49 0.14
50 0.16
51 0.16
52 0.15
53 0.19
54 0.18
55 0.17
56 0.17
57 0.22
58 0.22
59 0.3
60 0.37
61 0.43
62 0.51
63 0.57
64 0.58
65 0.59
66 0.59
67 0.58
68 0.56
69 0.56
70 0.55
71 0.52
72 0.59
73 0.57
74 0.55
75 0.52
76 0.54
77 0.54
78 0.53
79 0.58
80 0.58
81 0.63
82 0.7
83 0.72
84 0.72
85 0.71
86 0.72
87 0.73
88 0.68
89 0.65
90 0.6
91 0.56
92 0.59
93 0.59
94 0.58
95 0.59
96 0.63
97 0.67
98 0.7
99 0.78
100 0.79
101 0.82
102 0.85
103 0.84
104 0.85
105 0.86
106 0.86