Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074VA71

Protein Details
Accession A0A074VA71    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
67-88VEKQAPKRPKPPPKPSAPKSRVBasic
NLS Segment(s)
PositionSequence
69-87KQAPKRPKPPPKPSAPKSR
Subcellular Location(s) nucl 20, mito 4, cyto 2
Family & Domain DBs
Amino Acid Sequences MATSAAAHTLLNVLDQSDTSVAANTAAQTSSAPNAESELSLVPPSAHTTPRSTRSRKTRGSHNTEVVEKQAPKRPKPPPKPSAPKSRVLPSPPTRSTTTEPITLKSSDKLLRDYEKNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.09
4 0.08
5 0.08
6 0.08
7 0.08
8 0.08
9 0.08
10 0.08
11 0.07
12 0.08
13 0.07
14 0.07
15 0.07
16 0.08
17 0.09
18 0.1
19 0.1
20 0.09
21 0.1
22 0.1
23 0.1
24 0.1
25 0.08
26 0.08
27 0.08
28 0.08
29 0.07
30 0.07
31 0.1
32 0.11
33 0.12
34 0.13
35 0.18
36 0.22
37 0.3
38 0.37
39 0.38
40 0.44
41 0.52
42 0.59
43 0.63
44 0.62
45 0.64
46 0.66
47 0.71
48 0.69
49 0.63
50 0.57
51 0.5
52 0.47
53 0.39
54 0.34
55 0.26
56 0.25
57 0.28
58 0.32
59 0.34
60 0.42
61 0.51
62 0.58
63 0.67
64 0.73
65 0.74
66 0.79
67 0.86
68 0.84
69 0.85
70 0.79
71 0.76
72 0.7
73 0.69
74 0.64
75 0.57
76 0.6
77 0.57
78 0.62
79 0.56
80 0.56
81 0.52
82 0.52
83 0.53
84 0.51
85 0.46
86 0.44
87 0.43
88 0.41
89 0.41
90 0.38
91 0.35
92 0.29
93 0.32
94 0.29
95 0.31
96 0.32
97 0.35
98 0.41