Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074VS29

Protein Details
Accession A0A074VS29   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
133-163PEVNAKHRLKPARSRRHAKRAHKRETWDMVQBasic
NLS Segment(s)
PositionSequence
137-156AKHRLKPARSRRHAKRAHKR
Subcellular Location(s) nucl 14, mito 10, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000315  Znf_B-box  
Gene Ontology GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50119  ZF_BBOX  
Amino Acid Sequences SPAPVSSASMSHHDMALASLTHANNVQDIHEVRQAITRGFYHVRDWNRLQPGWTPHDSNLVCKHTSPWRDFRGQGVPPLEPIHYKKMFGQEGVLLCEDGRSGARCRVWLPCVLHCHKCDTYICKQCSEEHHRPEVNAKHRLKPARSRRHAKRAHKRETWDMVQKFSGQKLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.15
4 0.11
5 0.09
6 0.13
7 0.13
8 0.14
9 0.15
10 0.15
11 0.14
12 0.15
13 0.14
14 0.15
15 0.17
16 0.19
17 0.21
18 0.21
19 0.2
20 0.24
21 0.25
22 0.2
23 0.21
24 0.18
25 0.2
26 0.22
27 0.23
28 0.23
29 0.28
30 0.31
31 0.36
32 0.39
33 0.41
34 0.44
35 0.43
36 0.41
37 0.4
38 0.41
39 0.41
40 0.4
41 0.34
42 0.29
43 0.38
44 0.36
45 0.35
46 0.36
47 0.33
48 0.31
49 0.29
50 0.31
51 0.3
52 0.35
53 0.36
54 0.36
55 0.37
56 0.41
57 0.41
58 0.41
59 0.41
60 0.36
61 0.36
62 0.31
63 0.26
64 0.24
65 0.24
66 0.21
67 0.16
68 0.18
69 0.21
70 0.2
71 0.2
72 0.21
73 0.26
74 0.27
75 0.24
76 0.22
77 0.18
78 0.18
79 0.19
80 0.17
81 0.1
82 0.09
83 0.09
84 0.08
85 0.06
86 0.06
87 0.07
88 0.08
89 0.12
90 0.13
91 0.14
92 0.16
93 0.19
94 0.2
95 0.24
96 0.26
97 0.27
98 0.34
99 0.37
100 0.41
101 0.38
102 0.43
103 0.38
104 0.38
105 0.37
106 0.35
107 0.41
108 0.45
109 0.46
110 0.42
111 0.43
112 0.43
113 0.49
114 0.53
115 0.52
116 0.49
117 0.55
118 0.53
119 0.53
120 0.58
121 0.57
122 0.55
123 0.56
124 0.54
125 0.53
126 0.6
127 0.67
128 0.66
129 0.68
130 0.71
131 0.72
132 0.79
133 0.82
134 0.85
135 0.88
136 0.91
137 0.91
138 0.91
139 0.91
140 0.91
141 0.88
142 0.84
143 0.83
144 0.82
145 0.79
146 0.77
147 0.69
148 0.63
149 0.57
150 0.55
151 0.48