Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EYF7

Protein Details
Accession A7EYF7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-34LSKVSEQRKRSKRSKTFTECLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
KEGG ssl:SS1G_10373  -  
Amino Acid Sequences MSEISRRVSCRVVLSKVSEQRKRSKRSKTFTECLRYDTASKDSSAAVYTKINPGLWLHWLIGVKKVPRDDSNIPGTQTGAKCGMYDMMIAITIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.53
4 0.6
5 0.59
6 0.58
7 0.64
8 0.69
9 0.72
10 0.72
11 0.75
12 0.76
13 0.78
14 0.83
15 0.82
16 0.8
17 0.79
18 0.78
19 0.68
20 0.62
21 0.56
22 0.46
23 0.38
24 0.34
25 0.29
26 0.21
27 0.21
28 0.18
29 0.15
30 0.14
31 0.14
32 0.11
33 0.09
34 0.09
35 0.1
36 0.11
37 0.12
38 0.11
39 0.11
40 0.11
41 0.11
42 0.12
43 0.12
44 0.1
45 0.12
46 0.14
47 0.14
48 0.17
49 0.2
50 0.2
51 0.22
52 0.25
53 0.26
54 0.27
55 0.34
56 0.33
57 0.35
58 0.4
59 0.39
60 0.37
61 0.34
62 0.33
63 0.31
64 0.28
65 0.25
66 0.21
67 0.19
68 0.18
69 0.18
70 0.19
71 0.13
72 0.13
73 0.1
74 0.09
75 0.1