Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074VWW5

Protein Details
Accession A0A074VWW5   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
93-114TGIWVIRKQDRRKRPTQPDEITHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007018  Mediator_Med6  
IPR038566  Mediator_Med6_sf  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF04934  Med6  
Amino Acid Sequences PLDEVQFRRPDVIAYWEGIHENSIHPILRETPFFDPTTKNGLLWKQAEIHPPIWDMCRNRQAFETRLKQMNGVEYLIVGEPQPNPDPSLGPDTGIWVIRKQDRRKRPTQPDEITVLATYYLVGENMYQAPSVYDIVGNHLLSAMTSLTKFTQTAAPLPLYTPATGYTYFPPATAKSLVASQALSSTSREASTAPTPAELPSAAALDPAAQSTTSNELKSTKGADPRAQRALQDSLQMMLHYGDEYMDENPLRGEPGNFTFSAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.22
4 0.23
5 0.21
6 0.2
7 0.14
8 0.13
9 0.14
10 0.15
11 0.15
12 0.14
13 0.16
14 0.2
15 0.22
16 0.22
17 0.23
18 0.25
19 0.28
20 0.29
21 0.3
22 0.28
23 0.28
24 0.34
25 0.31
26 0.27
27 0.29
28 0.3
29 0.35
30 0.33
31 0.32
32 0.29
33 0.32
34 0.37
35 0.37
36 0.35
37 0.3
38 0.3
39 0.29
40 0.27
41 0.3
42 0.28
43 0.32
44 0.4
45 0.39
46 0.39
47 0.43
48 0.45
49 0.43
50 0.48
51 0.47
52 0.44
53 0.49
54 0.48
55 0.45
56 0.41
57 0.41
58 0.34
59 0.27
60 0.21
61 0.15
62 0.15
63 0.13
64 0.12
65 0.07
66 0.07
67 0.07
68 0.1
69 0.12
70 0.12
71 0.13
72 0.14
73 0.14
74 0.15
75 0.2
76 0.17
77 0.16
78 0.15
79 0.16
80 0.17
81 0.18
82 0.16
83 0.12
84 0.16
85 0.22
86 0.3
87 0.38
88 0.46
89 0.54
90 0.62
91 0.69
92 0.76
93 0.8
94 0.81
95 0.82
96 0.76
97 0.69
98 0.65
99 0.56
100 0.46
101 0.35
102 0.26
103 0.15
104 0.11
105 0.08
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.05
112 0.05
113 0.06
114 0.05
115 0.05
116 0.05
117 0.06
118 0.06
119 0.05
120 0.06
121 0.05
122 0.08
123 0.1
124 0.1
125 0.09
126 0.08
127 0.08
128 0.07
129 0.08
130 0.05
131 0.04
132 0.04
133 0.05
134 0.05
135 0.06
136 0.07
137 0.07
138 0.1
139 0.11
140 0.13
141 0.14
142 0.14
143 0.13
144 0.14
145 0.15
146 0.13
147 0.12
148 0.11
149 0.1
150 0.11
151 0.12
152 0.13
153 0.12
154 0.15
155 0.15
156 0.15
157 0.15
158 0.14
159 0.16
160 0.16
161 0.15
162 0.12
163 0.13
164 0.14
165 0.13
166 0.13
167 0.09
168 0.1
169 0.1
170 0.1
171 0.1
172 0.1
173 0.1
174 0.1
175 0.11
176 0.1
177 0.13
178 0.15
179 0.16
180 0.15
181 0.15
182 0.16
183 0.16
184 0.16
185 0.12
186 0.11
187 0.09
188 0.1
189 0.09
190 0.08
191 0.08
192 0.07
193 0.07
194 0.07
195 0.07
196 0.06
197 0.06
198 0.08
199 0.15
200 0.16
201 0.16
202 0.17
203 0.19
204 0.2
205 0.22
206 0.25
207 0.24
208 0.29
209 0.33
210 0.39
211 0.45
212 0.5
213 0.56
214 0.52
215 0.48
216 0.45
217 0.46
218 0.4
219 0.37
220 0.31
221 0.25
222 0.25
223 0.23
224 0.19
225 0.14
226 0.13
227 0.09
228 0.09
229 0.07
230 0.07
231 0.09
232 0.09
233 0.12
234 0.12
235 0.12
236 0.13
237 0.13
238 0.14
239 0.14
240 0.15
241 0.16
242 0.2
243 0.24