Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074W033

Protein Details
Accession A0A074W033   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
205-232VSSPSPAPGSNRKRKRRVEDDKSSVDKLHydrophilic
NLS Segment(s)
PositionSequence
215-221NRKRKRR
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MLLPRRDTPSAPSETKSIRKIRDEIAGGGVKGGRGLTKDEEQLLARIAVERFAEFKVPGKQGEFWNNVAAALKEERRVSYTPSSCTRRMGAIEKERRLEVKKEESGEERNTSSWAQSIDAWIALKDAWETADAYLSEEDEDALSDEDPRDEDNRQEEEGETKESQMERREEEEAKEEPMFLTPAKILKLQKAPSAQKSPSLPNLVSSPSPAPGSNRKRKRRVEDDKSSVDKLLKEEKEEKQQDSRLDRLEEKLDKIVDMINPSPLQHVETV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.53
4 0.53
5 0.53
6 0.56
7 0.59
8 0.57
9 0.59
10 0.55
11 0.48
12 0.46
13 0.42
14 0.35
15 0.32
16 0.29
17 0.2
18 0.18
19 0.16
20 0.11
21 0.1
22 0.14
23 0.17
24 0.2
25 0.22
26 0.23
27 0.25
28 0.25
29 0.24
30 0.22
31 0.18
32 0.14
33 0.15
34 0.14
35 0.14
36 0.14
37 0.13
38 0.14
39 0.14
40 0.16
41 0.13
42 0.18
43 0.23
44 0.25
45 0.26
46 0.26
47 0.29
48 0.33
49 0.4
50 0.39
51 0.33
52 0.33
53 0.31
54 0.29
55 0.26
56 0.2
57 0.15
58 0.15
59 0.15
60 0.16
61 0.17
62 0.18
63 0.21
64 0.22
65 0.24
66 0.3
67 0.32
68 0.33
69 0.4
70 0.45
71 0.43
72 0.44
73 0.4
74 0.34
75 0.34
76 0.35
77 0.36
78 0.4
79 0.47
80 0.48
81 0.48
82 0.47
83 0.47
84 0.44
85 0.4
86 0.36
87 0.36
88 0.37
89 0.37
90 0.38
91 0.38
92 0.39
93 0.38
94 0.34
95 0.26
96 0.23
97 0.23
98 0.21
99 0.18
100 0.15
101 0.12
102 0.11
103 0.1
104 0.1
105 0.09
106 0.09
107 0.09
108 0.07
109 0.07
110 0.06
111 0.06
112 0.05
113 0.04
114 0.04
115 0.05
116 0.05
117 0.05
118 0.07
119 0.07
120 0.08
121 0.07
122 0.07
123 0.07
124 0.06
125 0.06
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.05
132 0.05
133 0.05
134 0.05
135 0.06
136 0.08
137 0.08
138 0.1
139 0.14
140 0.16
141 0.16
142 0.16
143 0.16
144 0.16
145 0.17
146 0.19
147 0.15
148 0.13
149 0.15
150 0.15
151 0.18
152 0.21
153 0.22
154 0.2
155 0.22
156 0.26
157 0.25
158 0.25
159 0.27
160 0.23
161 0.23
162 0.21
163 0.18
164 0.15
165 0.15
166 0.14
167 0.1
168 0.1
169 0.09
170 0.11
171 0.12
172 0.16
173 0.17
174 0.22
175 0.29
176 0.3
177 0.34
178 0.4
179 0.44
180 0.47
181 0.53
182 0.47
183 0.46
184 0.47
185 0.47
186 0.44
187 0.44
188 0.36
189 0.31
190 0.32
191 0.3
192 0.26
193 0.24
194 0.2
195 0.17
196 0.19
197 0.17
198 0.2
199 0.28
200 0.38
201 0.46
202 0.56
203 0.64
204 0.73
205 0.82
206 0.87
207 0.88
208 0.89
209 0.89
210 0.89
211 0.87
212 0.85
213 0.8
214 0.71
215 0.63
216 0.54
217 0.46
218 0.39
219 0.41
220 0.35
221 0.36
222 0.42
223 0.45
224 0.53
225 0.56
226 0.56
227 0.54
228 0.58
229 0.6
230 0.58
231 0.58
232 0.52
233 0.52
234 0.5
235 0.46
236 0.49
237 0.45
238 0.43
239 0.42
240 0.38
241 0.33
242 0.31
243 0.3
244 0.25
245 0.26
246 0.24
247 0.24
248 0.24
249 0.25
250 0.27
251 0.24